KEGG   Bacillus gibsonii: BGM20_08510Help
Entry
BGM20_08510       CDS       T04820                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00020  Citrate cycle (TCA cycle)
bgi00480  Glutathione metabolism
bgi01100  Metabolic pathways
bgi01110  Biosynthesis of secondary metabolites
bgi01120  Microbial metabolism in diverse environments
bgi01130  Biosynthesis of antibiotics
bgi01200  Carbon metabolism
bgi01210  2-Oxocarboxylic acid metabolism
bgi01230  Biosynthesis of amino acids
Module
bgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGM20_08510
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BGM20_08510
Enzymes [BR:bgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BGM20_08510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOL30671
LinkDB All DBs
Position
complement(1636749..1638020)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtctctaacggagtattaaacgtaccaaacaacccg
attatcccatttatcgaaggagacggaaccggtcctgatatttggaacgcggcttcgaag
gttttggaagcagcagtagaaaaagcatacaaaggcgaaaagaaaattacatggaaagaa
gtttacgccggagaaaaggcttataataaaacaggtgagtggctccctgctgaaacatta
gatgtgatccgcgaatatttcatcgcgattaaaggcccgttaacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtatgcaaaaggctct
gaagaagtgcaaaagcttatcagcttccttcaaaatgagttaaacgtcaataaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttcagaagaaggaacaagccgcttg
gtcagagctgccattgattatgcgatcgagcatggccgcaaatctgtaacacttgttcac
aaaggaaacatcatgaagttcacagaaggcgccttcaaaaattggggctatgaacttgct
gaaaaagaatacggagataaagtctttacatgggctcaatatgaccgcattgctgaagaa
caaggaaaagatgctgccaacaaagcgcaaagcgaagcggaagcagcaggaaaaatcatt
atcaaagacagcattgctgacattttccttcagcagatcttaacgcgtccaaacgagttt
gatgtcgttgcgacaatgaacttgaacggagattacatttctgatgctcttgctgcgcaa
gtcggcggaatcggcattgctcctggagcgaacatcaactacgaaacaggacatgcgatt
ttcgaggcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttaggatggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttccaaagtcgtaacttacgattttgct
agattaatggacggggcgactgaagtgaaatgttcagagttcggagaagaactgatcaaa
aacatggactaa

DBGET integrated database retrieval system