KEGG   Bacillus gibsonii: BGM20_10530Help
Entry
BGM20_10530       CDS       T04820                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00071  Fatty acid degradation
bgi00362  Benzoate degradation
bgi00650  Butanoate metabolism
bgi01100  Metabolic pathways
bgi01120  Microbial metabolism in diverse environments
bgi01200  Carbon metabolism
bgi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BGM20_10530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGM20_10530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGM20_10530
Enzymes [BR:bgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BGM20_10530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA DUF3298 Lipase_GDSL_3 DUF4342
Motif
Other DBs
NCBI-ProteinID: AOL31029
LinkDB All DBs
Position
complement(2027139..2029508)
Genome map
AA seq 789 aa AA seqDB search
MHKHIRKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNDLTKEEEKKGLTKDSPEVRSR
LSRQAVKKLLKQKPAPLTSAKNTSYITPGNLEDDAEKLKEADWIIEVVVENLEVKKKIFA
LVDEHRKTGSIVSSNTSGISVQEMAEGRSDDFKAHFLGTHFFNPARYLKLLEIIPIKETD
PDILKFMTAFGENVLGKGVVTAKDTPNFIANRIGTYGLLVTVQEMLKGGYQVGEVDSITG
PLIGRPKSATFRTLDVVGLDTFAHVARNVYDKADGDEKEVFRLPSFMNDMLEKGWIGSKA
GQGFYKKEGKTIYELDPVTLTYGERTKMKTPALEAAKQAKGTKAKMKALIYSDDRAGRLL
WNITSQTLLYSAELLGEIADDIHAIDQAMKWGFGWELGPFEMWDAIGLKQSAEKLEQLGA
DMPGWIKEMLDKGNETFYIKENGTVFYYDRGEYRAVKENKKRIHLQALKETKGVIAKNSG
ASLIDLGDDVALLEFHSKSNAIGLDIIQMIHKGLEETERNYKGLVIGNQGKNFCVGANLA
MILMEVQDDNFLEVDFVIRRFQETMMKIKYSAKPVVAAPFGMTLGGGTEVCLPAARTQAA
SEAYMGLVESGVGLIPGGGGNKELYINHLRRGLDPMNAAMKTFETIAMAKVSASAQEARE
MNILKETDQISVNQDHLLYDAKQLAASLYDTGWRPPVKEKVKVPGETGYAALLLGAEQMK
LSGYISEHDFKIAKKLAYVIAGGKVPFGTEVDEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaacacattcggaaggcagccgttttaggatcgggggtaatgggttccgggatt
gcggcgcatttggctaacatcggaattcctgtcctgctgctagatattgtgccgaacgat
ttgacaaaggaagaggaaaaaaaggggctgacgaaggacagtccggaggtgcgcagcagg
ctgagccggcaggcggtgaaaaaactgctgaaacaaaagcccgctcccctcacatcagcg
aaaaatacctcctatattacaccgggcaatctggaggatgatgcagaaaaactgaaagaa
gcagattggattattgaggtcgttgtcgaaaaccttgaagtcaaaaagaaaattttcgct
cttgtggatgaacatcgaaagactggaagcatcgtctcaagcaacacatccggcatatca
gtgcaggaaatggctgaaggccggtcggatgattttaaagcccattttctcggaacgcat
ttttttaatcccgcacgctatttaaagctgctggagatcattccgattaaggaaacggat
cctgatattttaaagtttatgacagctttcggagaaaatgtcctcgggaaaggcgttgtt
acagcaaaggacacaccgaactttatcgcaaaccgcatcgggacgtacgggcttctcgtg
acagtccaagaaatgctgaaaggcggctatcaggtcggggaggttgattcgatcacagga
ccgctgatcggcaggccgaaaagcgctacctttagaacgcttgatgtggtcggtctcgat
acattcgcccacgttgcccgaaatgtgtatgacaaagctgatggcgatgaaaaagaagtg
tttcgccttccaagcttcatgaacgatatgctggaaaaagggtggatcggaagcaaggcc
ggccaaggcttttataaaaaagaaggaaaaacgatttatgagcttgacccagtgacgctt
acttacggcgagcggacaaaaatgaaaacaccggcacttgaagcggcaaaacaggcaaaa
gggacaaaagccaaaatgaaagcgcttatttattcggatgacagagccggccgattgctg
tggaatatcacatctcaaaccctgctttactcagccgagctgcttggcgagattgccgat
gatattcatgcgattgaccaagccatgaagtggggattcggctgggaactgggacctttt
gagatgtgggacgccatcggcctcaagcagtcagcggaaaagctcgagcagcttggagca
gatatgcctggctggataaaagagatgctggacaaaggaaatgaaaccttctacatcaaa
gagaacggaacggtattttattatgaccgcggcgaatacagagccgtgaaagaaaacaaa
aaacgaattcatttacaagcacttaaagaaacaaaaggcgtgattgcgaaaaacagcgga
gcaagcttaattgaccttggagatgatgtggcccttcttgaatttcattcgaaaagcaat
gcgatcggccttgatatcattcaaatgatccacaaaggattagaggaaacagaacggaat
tacaaggggcttgtcatcggcaatcaagggaaaaatttctgcgtcggcgcgaatctcgcc
atgatcttaatggaagtccaagatgacaactttttggaagttgattttgtgatccgccgt
tttcaggagacgatgatgaagatcaaatacagtgcgaaaccggtcgtcgccgcgccattt
ggcatgacgctcggcggaggaacggaagtatgcctgcctgcggcgcgtactcaagcggca
agcgaagcctatatgggccttgttgaatcaggtgtcggcctcatccctggcggaggaggt
aacaaagagctgtacatcaatcatcttcgccgcggccttgatccgatgaatgcggcaatg
aaaacatttgaaacgattgcgatggcgaaagtgtccgcttccgctcaagaggctcgtgag
atgaacatcttaaaagaaacggatcagatcagcgtgaatcaagaccacctgttatacgat
gcgaagcagctggccgcatctttatacgataccggctggcggccgcctgtaaaagaaaag
gtcaaggtgccgggagaaaccggttatgcggcactcttgcttggcgctgagcagatgaag
ctgtccggctatatatctgagcatgatttcaagatcgcgaaaaaactcgcttatgtcatt
gcgggcggaaaagtgccgtttggtacagaggttgatgaagagtatttattggagatcgaa
agagaagcgtttttgagtttggcaggagaggcaaaatctcaagcgagaatgcagcatatg
cttgtgaaaggtaaacctttacggaattag

DBGET integrated database retrieval system