KEGG   Bacillus gibsonii: BGM20_10580Help
Entry
BGM20_10580       CDS       T04820                                 

Definition
(GenBank) hypothetical protein
Organism
bgi  Bacillus gibsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 DUF3106
Motif
Other DBs
NCBI-ProteinID: AOL33013
LinkDB All DBs
Position
complement(2035913..2036158)
Genome map
AA seq 81 aa AA seqDB search
MEQKLQEQLDGLLEKYTELLLGETNDELKEEVKQWILYTHIAKSMPPLAKHWNATYPDAK
QGIKEIIQHIKELNEAHRNKQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaacttcaggagcagcttgatggattgctggagaagtatactgagcttctg
cttggtgaaacaaacgatgagctaaaagaagaagtgaagcaatggattttgtacacccat
atagccaaaagcatgcctccgctcgctaagcattggaatgcgacataccccgacgcgaag
cagggcattaaagagatcattcagcatattaaggaattaaatgaagcgcatcgaaacaaa
caatag

DBGET integrated database retrieval system