KEGG   Bacillus gibsonii: BGM20_13105
Entry
BGM20_13105       CDS       T04820                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00998  Biosynthesis of various secondary metabolites - part 2
bgi01100  Metabolic pathways
bgi01110  Biosynthesis of secondary metabolites
Module
bgi_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BGM20_13105
Enzymes [BR:bgi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BGM20_13105
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AOL31508
LinkDB
Position
complement(2537832..2539031)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKEMEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYAKAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKIVGAELYSFSKT
FNMAGWRMAFAVGNERIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVMRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaaatggaaaaaacgggagcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtggaggctttgcgggaggcttctctgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttaaaggaagcgatcgct
gctttctataaaagggaatacggagtgacaatcaatcctgaaacggaagtcgcgcttttc
ggaggcgggaaagccggattgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctatcctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaaaagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggagcgtttgaattcgatcaaaaaccggccagt
tttcttgaggcagaggatgccaaaattgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaggatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggcgctttgtgaaaaggaactgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattatttgctggagcatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaggaggatctgagggaattt
gtcatgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system