KEGG   Bacillus gibsonii: BGM20_14295Help
Entry
BGM20_14295       CDS       T04820                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgi  Bacillus gibsonii
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BGM20_14295
Enzymes [BR:bgi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BGM20_14295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like Thi4 AlaDh_PNT_C DAO FAD_oxidored NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AOL31731
LinkDB All DBs
Position
2781208..2782737
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKAEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRIGEIIVDKHGATSVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaacatcaaagcacaattaaatcaatatatgcagctaattgagaat
gatattgttctcaaagttagcgcaggcgaagatgacacttctaaggacatgctggctctc
gttgatgagctggcttccatgtcatcgaaaatttcagttgaaaaagctgaattaaacaga
acgccgagcttcagtgtcaatcgtgtcggagaagacactggcgtgactttcgccggtatc
cctctgggccacgaattcacatcattagtgttggcgctgctccaagtgagcggcagaccg
cctaaggtggaccaaaaagtcattgatcaggtgaagaagatcagtggtgaataccacttc
gaatcttatatcagcctgacatgccacaactgtcctgatgttgtacaagctttaaacatg
atgagcgtgctgaacccgaacattacgcacacgatgattgacggtgcagcatacaaagca
gaagttgaaagcaaaaacatcatggcagtgccgaccgtttacctgaatggcgaatccttc
ggaagcggccgtatgacgcttgaagaaattcttgcgaaaatgggcagcggcacagatgca
tctgagtttgctgacaaagagccgtttgacgttcttgttgtcggaggcggacctgctggt
gcaagtgcagcgatctacactgcacgtaaaggcatccgcactggtgttgtcgctgaacgc
ttcggcggacaggtactcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgacg
gaaggaccgaagcttgcggcaagtcttgaagagcatgtgaaggaatatgatattgatgtc
atgaaccttcagcgtgcgaaacgccttgagaagaaagatctgttcgaacttgaactcgaa
aacggcgctgtcctgaaaagtaaaacagtgatcctttcaacaggtgcacgctggcgcaat
gtcaacgtaccaggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gatgggccattgtttgaaggcaaagacgtagcggtaatcggcggcggaaactctggtatt
gaagcagcgattgaccttgcaggtattgtcaatcacgttactgtgctagagttcgcaccg
gaactgaaagcagacgaagtcctgcaaaaacgtctctacagcctgcctaacgttactgtt
gtaaaaaacgcacaaacaaaagaaatcacaggcgatcagagcgttaacggcatcacatac
gtagaccgcgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagaaggaacggttgaacgcaaccgcatcggcgaa
atcattgtcgacaaacacggcgcaacaagcgtaccaggcttatttgctgccggcgactgc
acagacagtgcgtacaatcaaattattatttctatgggatcaggtgcaactgccgccctc
ggcgcgtttgattacctaatccgtaactga

DBGET integrated database retrieval system