KEGG   Bacillus gibsonii: BGM20_14665Help
Entry
BGM20_14665       CDS       T04820                                 

Definition
(GenBank) hypothetical protein
  KO
K06888  uncharacterized protein
Organism
bgi  Bacillus gibsonii
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BGM20_14665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredox_DsbH Thioredoxin_7 Glyco_hydro_76 Glyco_hydro_88 GlcNAc_2-epim LANC_like Thioredoxin_2 Pectate_lyase_2
Motif
Other DBs
NCBI-ProteinID: AOL31795
LinkDB All DBs
Position
2848856..2850925
Genome map
AA seq 689 aa AA seqDB search
MPNKSKPNRLINEKSPYLLQHAHNPVDWFPLGEEAFEKAKRENKPVLVSIGYSTCHWCHV
MAHESFEDEEIARLLNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQK
PFYAGTYFPKTSKFNRPGFVDVLEHLSETFANDREHVEDIAENAAKHLQTKTAAKSGEGL
SESAIHRTFQQLASGFDTIYGGFGQAPKFPMPHMLMYLLRYHHNTGQENALYNVTKTLDS
MANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYSEAYQVTQNSRYKEICEQ
IITFIQREMTHEDGSFFSALDADTEGEEGKYYVWSKEEILKTLGDDLGTLYCQVYDITEE
GNFEGKNIPNLIHTKREQIKEDAGLTEKELSLKLEDARQQLLKTREERTYPHVDDKVLTS
WNALMIAGLAKAAKVYQEPKYLSLAKDAITFIENKLIIDGRVMVRYRDGEVKNKGFIDDY
AFLLWAYLDLYEASFDLSYLQKAKKLTDDMISLFWDEEHGGFYFTGHDAEALIVREKEVY
DGAVPSGNSVAAVQLLRLGQVTGDLSLIEKAETMFSVFKPDIDAYPSGHAFFMQSVLRHL
MPKKEIVIFGSADDPARKQIIAELQKAFKPNDSILVAELPDQCKDIAPFAADYRIIDGKT
TVYICENFACQQPTTNIEEAIHTLISSRD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaaaagtaaacccaatagattaatcaatgagaaatcaccatacctactccaa
cacgcccacaaccctgtggactggttccctttgggagaagaagcatttgagaaagcgaaa
cgcgaaaacaagccggttctggtcagcatcggttattcgacttgtcattggtgccacgtg
atggctcacgaaagctttgaagacgaagaaatcgcgcgtcttctcaatgaacggtttgtg
gcgattaaagtcgaccgggaagagcggcctgatgtggattctgtttatatgagaatctgc
cagctgatgaccgggcagggcggctggccgctgaatgtgtttatcacgcctgatcaaaag
ccgttttacgcgggtacatattttccaaagacgagcaaattcaaccgtcccggttttgtt
gatgtgcttgagcatctgtctgagacatttgcgaacgaccgcgagcatgtcgaggatatt
gcggagaacgccgctaaacatttgcagaccaaaacagccgccaaatcaggcgaaggcctt
agcgagtcagcgattcaccggacattccagcagcttgccagcgggtttgatacgatctac
ggcggtttcgggcaggcaccgaaatttccgatgccccatatgctgatgtatttgcttcgt
tatcatcacaatacggggcaggagaacgctttatacaacgtgacgaaaacgctggacagc
atggcgaatggcggcatttacgatcatatcggctatgggtttgcacgctattcgaccgat
gacgagtggctcgttccccactttgaaaaaatgctgtacgacaatgcgctgttgctgacc
gcttattcagaagcctatcaggtcacgcaaaacagccgctataaagagatttgtgagcag
atcattacgttcattcagagggaaatgactcatgaagacggaagctttttctctgcttta
gacgcggatacagaaggagaagaaggaaagtactacgtgtggtcaaaggaagagattctg
aaaacgctcggggacgatctcggaacgctgtattgccaagtgtatgacatcactgaagaa
ggaaactttgaaggcaaaaatattcctaacctcattcacacaaagcgagaacaaatcaaa
gaggatgccgggttaaccgaaaaagagctcagtctcaaactcgaagacgcaagacagcag
ctcttgaagacacgcgaggaaagaacctatccccatgtcgatgataaagtgctgacctca
tggaacgcgctgatgatcgcgggtcttgcgaaagcggcaaaggtataccaggaaccgaaa
tatctcagcctagcgaaagacgccatcacatttattgaaaacaaattaatcatcgacggc
cgtgtgatggtccgatatcgtgatggcgaagtgaaaaacaaaggctttatcgacgattac
gcttttctcctatgggcttatctggatctctatgaagcttcgtttgatctttcttattta
caaaaagcgaagaaactgacagacgatatgatcagcttattttgggatgaggagcatggc
ggattctacttcaccggacacgatgcagaagccttaatcgtacgggaaaaagaagtgtac
gacggcgccgtgccttccggaaacagtgtggcagctgttcagctgctgcgtctcgggcaa
gtcacaggcgacttatcactgatcgaaaaagcggaaacgatgttttccgtgttcaagcca
gacatcgacgcgtatccgagcggccatgctttctttatgcaaagtgtgttaaggcatcta
atgcctaaaaaagaaatcgttatttttggcagcgcagatgatccagccagaaaacaaatc
atagcggagcttcaaaaagcctttaagcccaacgactccattctggtagcagagcttcct
gatcaatgcaaagacattgcgccattcgctgcagactaccgcatcatagacggcaaaaca
accgtttatatttgtgaaaacttcgcctgccagcagccgacaacgaatatcgaagaagcc
atccacacgttaataagcagcagggattaa

DBGET integrated database retrieval system