KEGG   Bacillus gibsonii: BGM20_17420Help
Entry
BGM20_17420       CDS       T04820                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00473  D-Alanine metabolism
bgi01100  Metabolic pathways
bgi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BGM20_17420
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BGM20_17420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgi01011]
    BGM20_17420
Enzymes [BR:bgi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BGM20_17420
Peptidoglycan biosynthesis and degradation proteins [BR:bgi01011]
 Precursor biosynthesis
  Racemase
   BGM20_17420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOL32268
LinkDB All DBs
Position
3389087..3390256
Genome map
AA seq 389 aa AA seqDB search
MSTKSFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMTVVKANAYGHGDAETAKAALDAG
ASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHT
KKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFL
MQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADISDEIPF
QLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDECISMDEIAGRLETINYEVACT
ISSRVPRMFLENGSIMEVRNPLLQVNTSN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaatctttttacagagatacgtgggcggaaattgacttgtccgcgataaag
gaaaatgtcagcaatatgaaaaaacatatcggtgaacatgtccacctgatgacagttgtg
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggctgctcttgacgcaggt
gcttcatgcctggccgtggccattttggatgaagcgatttcactgcgcaaaaagggattg
aaggcgcctatattggtgcttggcgcggttcccccagagtatgttgcaatcgctgctgag
tatgacgtgaccttaacaggttattctgttgaatggcttcaggaggcagcccgccacacg
aaaaaaggttctcttcattttcatctgaaggtcgatacggggatgaacaggcttggtgta
aaaacagaggaagaagttcagaacgtgatggccattcttgaccgcaatcctcgtttaaag
tgcaaaggggtatttacccattttgcgacagcggatgaaaaagaaagaggctatttctta
atgcagtttgagcgctttaaagagctgattgctccgctgccgttaaagaatctaatggtc
cactgcgcgaacagcgccgccggactccggctgaaaaaaggcttttttaatgcagtcaga
ttcggcatcggcatgtatggccttcgcccgtctgctgacatttcggacgagataccgttt
cagctgcgtccggcatttaccctgcattcgacgctgtcgcatgtcaaactgatcagaaaa
ggcgagagcgtcagctacggagccgagtacacagcagaaaaagacacatggatcgggacg
gtgcctgtaggctatgcggacggctggctccgaaaattgaaagggactgacatccttgtg
aagggaaaacgcttgaaaattgccggccgaatttgcatggaccaatttatggtggagctg
gatcaggaatatccgccgggcacaaaagttacattaataggccggcagggggatgaatgt
atttccatggatgagattgcaggaaggcttgaaaccattaactatgaggtggcctgtaca
ataagttcccgtgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttattgcaggtaaatacaagcaattaa

DBGET integrated database retrieval system