KEGG   Bacillus gibsonii: BGM20_19220Help
Entry
BGM20_19220       CDS       T04820                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00010  Glycolysis / Gluconeogenesis
bgi00020  Citrate cycle (TCA cycle)
bgi00620  Pyruvate metabolism
bgi01100  Metabolic pathways
bgi01110  Biosynthesis of secondary metabolites
bgi01120  Microbial metabolism in diverse environments
bgi01130  Biosynthesis of antibiotics
bgi01200  Carbon metabolism
Module
bgi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGM20_19220
   00020 Citrate cycle (TCA cycle)
    BGM20_19220
   00620 Pyruvate metabolism
    BGM20_19220
Enzymes [BR:bgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BGM20_19220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 HlyD_D23 Biotin_lipoyl_2 PYNP_C RnfC_N GCV_H DUF2118
Motif
Other DBs
NCBI-ProteinID: AOL32594
LinkDB All DBs
Position
3735679..3736875
Genome map
AA seq 398 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSIWNKKVGDPVEKGESIASIQSEKIEMEIEAPEKGTLIDIK
VKEGEEVPPGTAICYIGDANESVQEEAGAPVAEDNMPQAVQPVKQENKPAASKKDRMKIS
PVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKKDQAKPVSEQKAQEIPVTGMR
KVIAARMQESLANSAQLTITMKADITKLATLQKQLSPTAEERYGTKLTITHFVSRAAVLA
LQAHPVLNSLYQNERIITHPHVHLGMAVALENGLVVPVIRHAEKLSLIELAQSISENAKK
AREGRAGSEELQGSTFSITNLGAFGVEHFTPILNPPETGILGIGASYDTPVYQGEEIVRS
TILPLSLTFDHRACDGAPAAAFLKVMKTYLEEPAALIL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaaaagtagtgatgccaaaattgggaatggccatgaaacaaggggaagtatcg
atatggaataaaaaagtaggcgacccggttgaaaagggagaaagcattgccagcattcaa
tcggagaaaattgaaatggagatcgaagcgcctgaaaaaggaacgctgatcgatatcaaa
gtgaaagagggagaagaggttccgcccggcacagctatttgctatatcggggacgccaat
gagtcggtgcaggaagaggcgggggcgcctgttgctgaagacaatatgccgcaagccgtt
cagcccgtcaaacaagaaaacaaacccgcagcctccaaaaaagatcgaatgaaaatatct
ccagtcgccaggaaaatagcagaaaaagcaggattagacctaaaacaactgaaaggaact
ggaccaggcggacgaatcgtgaaggatgacgtaacaaaggctcttgctgaacagaaaaaa
gatcaagcaaagcctgtttcggagcagaaagcgcaggaaatcccggtgacaggcatgaga
aaggtcatcgctgcccgaatgcaggaaagcctggcaaacagcgcgcagctgacgatcacg
atgaaagctgatatcaccaagcttgccactcttcaaaaacagctttcaccaactgcggaa
gagagatacggcacaaaactgacgatcactcattttgtctcaagagccgccgttctcgct
ctgcaagctcatcctgtgctgaacagcctttatcaaaatgagcgcattatcacacatccc
catgtacaccttggtatggctgtagccttggaaaatggcttagtggtgcctgtcatccgc
catgctgaaaagctatcgctgattgaactggctcaatccatctcagaaaatgccaaaaaa
gcacgcgagggacgtgcgggaagcgaagaactgcaaggctctaccttctccattacaaac
cttggcgcgtttggagttgagcatttcacaccgatactaaatccgccggaaacaggcatt
ctcggcatcggagcaagctatgacacaccggtgtatcaaggagaggagatcgtcagaagc
acgatcctgcctctcagcctgacatttgatcacagagcgtgtgacggcgcccctgccgct
gcattcctgaaggtgatgaaaacatatttggaagaacccgcagcattaattttatag

DBGET integrated database retrieval system