KEGG   Brenneria goodwinii: AWC36_08070Help
Entry
AWC36_08070       CDS       T05061                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
bgj  Brenneria goodwinii
Pathway
bgj00010  Glycolysis / Gluconeogenesis
bgj01100  Metabolic pathways
bgj01110  Biosynthesis of secondary metabolites
bgj01120  Microbial metabolism in diverse environments
bgj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWC36_08070
Enzymes [BR:bgj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AWC36_08070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ATA24070
UniProt: A0A0G4K0X3
LinkDB All DBs
Position
1846209..1847084
Genome map
AA seq 291 aa AA seqDB search
MNDKIFKLPIINPITSTISQRQLEQLPVIVVEHPQVRAAVTLQGAHLLNWQPTGEAPVLW
LSDNTAFTEHVAIRGGIPICFPWFGPYAEPNHGFARLLPWEFTSHSEDEQGVELAFTLRD
TAKTRESWPHEFTLIARFKLGKTCHVELEAHGDYSFTSALHTYFQIGDIGKIAISGLGDQ
YIDKVNQGKVSAQQGDLVFTDRTDRIYTHPQSISVINDPVLQRTIEVHHTNYSDVVSWNP
GAELSHTISDMTDEGYKTFVCVETARINQPLTATVQSPARLSTLIRIKKSS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataagattttcaaactccccatcatcaacccaattacctcaaccatcagccag
cgacagttggaacaactgccggtgattgtcgtcgagcatccccaggttcgcgcagctgta
acattacaaggcgcgcatctgctgaactggcaaccaacgggcgaagcgcctgtgctttgg
ctaagcgataacacggccttcactgagcatgtggctattcgtggcggtatccctatctgt
ttcccatggtttggcccgtatgctgaacctaaccacggtttcgcacgcctgctgccgtgg
gaattcacgtctcatagcgaagatgaacaaggtgtggaattggctttcacactgcgcgac
acggcgaaaacccgtgaatcctggccgcatgaatttacccttatcgcccgtttcaaattg
ggtaaaacatgtcatgtcgaattggaagcgcacggtgattacagctttaccagcgcatta
cacacctactttcaaatcggcgatatcggcaagatcgctatcagcgggctgggcgatcaa
tatattgataaagtcaatcagggcaaggtatccgctcaacaaggggatctggtatttacc
gatcgcaccgaccgtatttacacccatccgcagagtattagcgttattaatgacccggtg
ttgcaacgcacgattgaagtgcaccataccaactatagcgacgtcgtttcatggaatccc
ggcgcggaactatcacataccattagtgatatgactgacgaaggctataaaacctttgtc
tgcgtagaaacggcgcgtattaatcagccgttaaccgcgacagtgcagtcacctgcccga
ttatccacgcttattcgtatcaagaaatcgtcataa

DBGET integrated database retrieval system