KEGG   Brenneria goodwinii: AWC36_17480Help
Entry
AWC36_17480       CDS       T05061                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bgj  Brenneria goodwinii
Pathway
bgj00010  Glycolysis / Gluconeogenesis
bgj00030  Pentose phosphate pathway
bgj00051  Fructose and mannose metabolism
bgj00052  Galactose metabolism
bgj00680  Methane metabolism
bgj01100  Metabolic pathways
bgj01110  Biosynthesis of secondary metabolites
bgj01120  Microbial metabolism in diverse environments
bgj01130  Biosynthesis of antibiotics
bgj01200  Carbon metabolism
bgj01230  Biosynthesis of amino acids
bgj03018  RNA degradation
Module
bgj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWC36_17480
   00030 Pentose phosphate pathway
    AWC36_17480
   00051 Fructose and mannose metabolism
    AWC36_17480
   00052 Galactose metabolism
    AWC36_17480
  09102 Energy metabolism
   00680 Methane metabolism
    AWC36_17480
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AWC36_17480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bgj01009]
    AWC36_17480
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bgj03019]
    AWC36_17480
Enzymes [BR:bgj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AWC36_17480
Protein phosphatases and associated proteins [BR:bgj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AWC36_17480
Messenger RNA biogenesis [BR:bgj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AWC36_17480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ATA25754
UniProt: A0A250BHZ8
LinkDB All DBs
Position
complement(3990490..3991452)
Genome map
AA seq 320 aa AA seqDB search
MIKRIGVLTSGGDAPGMNAAIRGVVRTALTEGLEVFGIYDGYLGLYENRMAQLDRYSVSD
MINRGGTFLGSARFPEFREAEVREVAIQNMKAQGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVEFSPEDLVEEIKVGIDKGKKHAIVAITEHICDINELSKYIEKETG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKLVHHDIIDA
IENMKRPFKKDWLDTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagaatcggagtattgacgagtggtggcgatgcacccggcatgaatgcggca
attcgtggtgtggtacgtactgcgctgacggaagggttggaagttttcggcatttatgat
ggctatctggggttgtatgagaatcggatggcgcagttggatcgctacagcgtatccgac
atgatcaaccgtggcggtactttcctgggttcggctcgttttcctgaatttcgcgaagcg
gaagtgcgcgaagtcgccatccagaacatgaaagcgcaggggcttgatgctctggtggtt
atcggcggcgatggttcctatatgggggctaagcgcttgacggagatggggttcccttgt
atcggtttacccggcacgattgacaacgatgttgcgggcaccgactacactatcggttac
ttcaccgcgctggaaacggtgctggaagccattgaccgcctgcgcgatacctcttcatcg
caccaacgtatttccattgttgaagtgatggggcgtcattgcggcgacttaacgctggcc
gcggcgattgccggcggttgtgaattcatcgttctgcccgaagtggaattcagcccggaa
gatctggttgaggagatcaaggtcggtattgataaaggtaaaaaacacgccatcgtcgcg
attaccgaacacatctgcgatattaatgagctgtcgaaatatatcgagaaagagaccggc
cgtgaaacgcgcgctaccgtgctgggacatattcagcgcggcggttctccggtggcatac
gaccgcatcctcgcttcccgcatgggcgcttactcaatagagctgctgctgcaaggctat
ggtggccgttgcgtcggtatccagaatgaaaaactggtgcatcatgacatcatcgatgcg
attgagaacatgaagcgtccctttaagaaagactggctggatacggctaagaaactgttc
tga

DBGET integrated database retrieval system