KEGG   Brenneria goodwinii: AWC36_17615Help
Entry
AWC36_17615       CDS       T05061                                 

Definition
(GenBank) class II aldolase
  KO
K22130  3-dehydro-4-phosphotetronate decarboxylase [EC:4.1.1.104]
Organism
bgj  Brenneria goodwinii
Brite
KEGG Orthology (KO) [BR:bgj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AWC36_17615
Enzymes [BR:bgj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.104  3-dehydro-4-phosphotetronate decarboxylase
     AWC36_17615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ATA25779
UniProt: A0A0G4JSK2
LinkDB All DBs
Position
complement(4016748..4017371)
Genome map
AA seq 207 aa AA seqDB search
MNEVQAREEMVRLGASFFQRGYATGSAGNLSLLLEDGALLATPTGSCLGELSADRLAKVG
LEGELISGDRPSKEISFHLALYRHNPQCRAVVHLHSAYSTALSCLEGLDPRNAIRPFTPY
VVMRMGRVPVVPYFRPGDKRLGEELARLAPDHNAFLLANHGPVVTGRSLRAAADNMEELE
ETAKLVFILGDRRIRYLTDAEIAELRS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagttcaagcacgagaagaaatggtcagactgggcgcctctttttttcagcgc
ggatatgccaccggctcggccgggaacctttccctgctgctggaggacggggcgctgctg
gcaacgccgacgggctcctgcctgggggaactctccgccgaccggctggcgaaggttggt
ctggagggagaattgatctccggcgacagaccctctaaggaaatcagcttccatctggcc
ctctatcgccataatccgcagtgtcgggccgtggtgcacctgcatagcgcctattcgacg
gcgctatcttgcctggagggactggatccgcgcaacgcgatccggcccttcaccccttat
gtggtgatgcggatgggacgagtgccggtcgttccctatttccgtcccggcgacaagcgg
ctgggcgaagaattggccaggttggcgcccgaccacaacgcttttctcctggccaatcac
ggtccggtcgtgaccggacgaagcctgcgcgccgccgcggacaatatggaagagctggaa
gagaccgccaaactggtcttcattctgggcgaccgccggatccgctatctgaccgacgca
gaaattgccgaattaaggagctaa

DBGET integrated database retrieval system