KEGG   Burkholderia glumae BGR1: bglu_1g00950Help
Entry
bglu_1g00950      CDS       T00905                                 

Definition
(GenBank) Aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00620  Pyruvate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_1g00950
   00620 Pyruvate metabolism
    bglu_1g00950
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     bglu_1g00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACR27298
UniProt: C5A889
LinkDB All DBs
Position
1:complement(103165..104685)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQHLNIEFPYRKQYGNFIGGKWVPPVGGDYFDNVSPVTGKPFTSIPRSQAADIEL
ALDAAHAARAAWGATPAADRAGILLKIADRMEANLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVWAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKVAFTG
ETSTGRLIAGYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAVQRVEKIRQGHPLDAQTMIGAQASEEQMEKILSYIEIGR
QEGAECLTGGARNTMTGELASGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEAEAL
EIANDTPYGLGAGLWTRDGNRAYHFGRNIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDKPAGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgccgagatgcaacacctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcgggggcaaatgggtgccgccggtcggcggcgactatttcgacaacgtctcg
cccgtcacgggcaagccgttcacgtcgatcccgcgctcgcaggcagccgacatcgagctc
gcgctcgacgcggcgcacgcggcgcgcgccgcctggggcgcgaccccggcggccgaccgc
gcgggcatcctgctcaagatcgccgaccgcatggaggcgaacctggcacgcctcgcggtg
gccgagacgatcgacaacggcaagccgctgcgcgagaccaccgcggccgacatcccgctc
gccatcgaccatttccgctatttcgcgggctgcgtgcgcgcgcaggaaggttcgatcgcc
gacatcggcggcgacctggtggcctaccacttccatgagccgctcggcgtggtcggccag
atcattccgtggaacttcccgatcctgatggccacctggaagctcgctccggcgctcgcg
gccggcaactgcgtggtgctgaagccggccgagcagaccccggcctcgatcctggtgtgg
gccgagctgatccaggacctgctgccgcccggcgtgctcaacatcgtcaacggcttcggg
ctcgaggccggcaagccgctcgcctccagcaagcggatcgccaaggtcgcgttcaccggc
gagacctccaccggccgcctgatcgccggctacgcgagcgcgaacctgatcccggtcacg
ctcgaactcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgagggctttgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctggtcgaggaaagcatctacgagcgcttcatcgagcgc
gccgtgcagcgcgtcgaaaagatccgccagggccatccgctcgacgcgcagaccatgatc
ggcgcgcaggcctccgaggagcagatggagaagatcctgtcgtacatcgagatcggccgc
caggaaggcgccgaatgcctgacgggcggcgcgcgcaacaccatgacgggcgaactggcg
agcggcttctacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtgctgtcggtgaccaccttcaagaacgaggccgaggcgctc
gagatcgccaacgacacgccctacggcctgggcgccggcctctggacccgcgacggcaac
cgcgcctatcacttcggccgcaacatccaggccgggcgcgtctggaccaactgctaccac
gcctatccggcgcacgcggcgttcggcggctacaagcagtccggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctatagcgac
aagccggccggcctgttctga

DBGET integrated database retrieval system