KEGG   Burkholderia glumae BGR1: bglu_1g04640Help
Entry
bglu_1g04640      CDS       T00905                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00473  D-Alanine metabolism
bgl00550  Peptidoglycan biosynthesis
bgl01100  Metabolic pathways
bgl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bglu_1g04640
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    bglu_1g04640
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    bglu_1g04640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgl01011]
    bglu_1g04640
Enzymes [BR:bgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     bglu_1g04640
Peptidoglycan biosynthesis and degradation proteins [BR:bgl01011]
 Precursor biosynthesis
  Amino acid ligase
   bglu_1g04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp CPSase_L_D2 ATP-grasp_3 TTL ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: ACR27661
UniProt: C5AAD9
LinkDB All DBs
Position
1:490869..491810
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLFGGVSAEREVSLNSGRLVLQGLREAGIDAHLFDPSERPLSALKDE
GFVRAFNALHGGYGENGQLQGALDFYGIRYTGPGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDHAARAAEIVAKLGLPLFVKPASEGSSVAVIKVKDAAALPAALDEAGRHDRI
VIVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYLADDTQYLIPCGIEAAKET
EFKRLARRAFEVLGCSGWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLDD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtactgttcggcggcgtgtcc
gccgagcgcgaggtgtcgctgaattcgggccggctggtgctgcagggtctgcgcgaggcg
ggcatcgacgcgcatctgttcgatccgtccgagcggccgctgtcggcgctgaaggacgag
ggcttcgtgcgcgcgttcaacgcgctgcacggcggttacggcgagaacggccagctccag
ggcgcgctcgatttctacgggatccgctataccggccccggcgtgctcggctcggcactc
ggcctcgacaagttccgcaccaagctggtctggcagcagaccggcatcccgacgccgccg
ttcgagaccgtgatgcgcggtgacgaccacgccgcgcgcgcggcggagatcgtcgcgaag
ctgggcctgccgctgttcgtgaagccggcgagcgagggctcgagcgtcgccgtgatcaag
gtgaaggacgccgccgcgctgccggccgcgctcgacgaggcgggccggcacgaccggatc
gtgatcgtcgagaagagcatcgaaggcggcggcgagtacacggcctgcatcgcgggcgac
ctcgatctgccggtgatccgcatcgtgccggcgggcgagttctacgactatcacgcgaag
tacctcgccgacgacacgcagtacctgatcccatgcgggatcgaggcggctaaggaaacg
gaattcaagcggctcgcgcgccgtgcgttcgaggtgctcggctgcagcggctggggccgc
gccgatttcatgctcgacgcggcgggcaacccgtatttcctggaagtgaacacggcgccg
gggatgaccgaccactcgctgccgccgaaggccgcgcgcgcggtgggcatcagctactcg
gagctggtggtgaaggtgttgtcgctgacgctggacgactga

DBGET integrated database retrieval system