KEGG   Burkholderia glumae BGR1: bglu_1g12510Help
Entry
bglu_1g12510      CDS       T00905                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00473  D-Alanine metabolism
bgl01100  Metabolic pathways
bgl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bglu_1g12510
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    bglu_1g12510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgl01011]
    bglu_1g12510
Enzymes [BR:bgl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     bglu_1g12510
Peptidoglycan biosynthesis and degradation proteins [BR:bgl01011]
 Precursor biosynthesis
  Racemase
   bglu_1g12510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACR28410
UniProt: C5AET6
LinkDB All DBs
Position
1:1368926..1369996
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLAAARRFAPRSKVWAVVKANAYGHGLARAFPGLRGTDGFGLLD
VDEAVRLRELGWAGPILLLEGFFRSTDVDVIDRYSLTTALHNDDQMRMLETARLSKPVNI
LLKMNSGMNRLGYSVDKYRAAWERARTCPGIGQITLMTHFADADGERGVAAQMAAFERGA
EGIAGARCLANSAAVMWHAQTHHDWVRPGILLYGASPSGRAADIADAGLQPAMTLASELI
AVQSIKAGDAVGYGGAFVATQAMRIGVVACGYADGYPRVAPEGTPVLVDGVRTRIVGRVS
MDMITVDLTPVPQAGIGARVELWGRALPVDDVAAHCATVGYELMCAVAQRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgattcataccgccgcacttgctaacaatctcgcggcc
gcgcgccgtttcgcgccgcgctcgaaggtctgggccgtcgtcaaggccaatgcctacggg
cacggcctcgcgcgcgcgttccccgggctgcgcggcaccgacggcttcggcctgctcgac
gtcgacgaggcggtgcgcctgcgcgagctgggctgggcggggccgatcctgctgctcgag
ggcttcttccgctcgaccgacgtggacgtgatcgatcgctacagccttaccaccgcgctg
cataacgacgatcagatgcgcatgctcgagacggcgcgcctgtcgaagccggtcaacatc
ctcttgaagatgaacagcggcatgaaccggctcggctattcggtcgacaagtatcgcgcg
gcctgggagcgtgcgcggacctgtcccggaatcggccagatcacgctgatgacgcacttc
gccgatgccgacggcgagcgcggcgtggccgcgcagatggccgcgttcgagcgcggcgcc
gagggcatcgccggcgcgcgctgcctcgcgaactcggccgccgtgatgtggcacgcgcaa
acccatcacgactgggtgcgccccggcatcctgctgtatggcgcctcgccctcgggccgc
gcggccgacatcgccgacgccgggctgcagccggccatgacgctcgcctccgagctgatc
gccgtgcagtcgatcaaggcgggcgacgcggtgggttacggcggcgcgttcgtcgccacg
caggcgatgcggatcggcgtggtggcctgcggctatgccgacggctatccgcgggtcgcg
ccggagggcacgccggtgctggtcgacggggtgcgcacgcggatcgtcggacgcgtctcg
atggacatgatcacggtcgacctgacgccggtgccgcaggccgggatcggcgcgcgcgtc
gagctctggggccgcgcgctgccggtcgacgacgtggccgcgcactgcgcgacggtgggc
tacgaactgatgtgcgcggtggcccagcgcgtgccggttcgggcggaataa

DBGET integrated database retrieval system