KEGG   Burkholderia glumae BGR1: bglu_1g14350Help
Entry
bglu_1g14350      CDS       T00905                                 

Definition
(GenBank) DNA polymerase III, subunits gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl03030  DNA replication
bgl03430  Mismatch repair
bgl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    bglu_1g14350
   03430 Mismatch repair
    bglu_1g14350
   03440 Homologous recombination
    bglu_1g14350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bgl03032]
    bglu_1g14350
   03400 DNA repair and recombination proteins [BR:bgl03400]
    bglu_1g14350
Enzymes [BR:bgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     bglu_1g14350
DNA replication proteins [BR:bgl03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     bglu_1g14350
DNA repair and recombination proteins [BR:bgl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     bglu_1g14350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA DNA_pol3_tau_5 RuvB_N AAA_16 AAA_14 AAA_5 AAA_22 TsaE AAA_18 DUF3646 Mg_chelatase AAA_30 AAA_assoc_2 Acetyltransf_6 AAA_24
Motif
Other DBs
NCBI-ProteinID: ACR28583
UniProt: C5AFH6
LinkDB All DBs
Position
1:1579718..1582303
Genome map
AA seq 861 aa AA seqDB search
MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAK
ALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARF
KVYMIDEVHMLTNHAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPA
GHIVMHLERILGEERVAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGM
LGALDQTYMVRLLDAIASSDGPEILAIADEMALRSLSFSTALQDLAGLLHRIAWAQFAPA
SVLDEWPEAADLRRFAEALSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRMLAFAP
AASGGAPVPGAAPAVAAGGRRAAAPVAPAGAGARDAAAHAMPPVAAAASARPAPAPVAQA
AAEPPPAAVAAPRAVPPAAARDVATAKRPAELPVRAEQARPAESDEAAAVAPRESAPDLA
DEPAESPLASQLESSDVALGAGPTPPAEPAAMLEPSLRADTPPMAESAAEAAFAEDVSSL
PAALPQASPPSADAAPLAAAPRPDRVEPAAVRPPAAPVAAPGERSDALRGGGAAAALDVL
RNAGMRVSSDRGRAASAAKPAPAAKSAAPRVNVPTPRPRTAQPSRPAAAADPSAPPPWDD
MPPDDYLPISADDHYGPPPDDGYLPVFDSSPDDVRVAPQPAPAPADTRPLPPAIALDAIG
YAGEWPQLAATLTLKGVAYQLAFNSELISAQGGVLKLAVPVPQYADAAQVVKLKTALAEA
LGKPVEVAVEVGPARRTAAALDAVERAKRQREAEQEIGADPFVQQLIRDFGARIVEGSVR
PVASDAAAAGPAGQCGAPTLH
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcaagttctcgcacgcaagtggcgtccgaaggatttcgcttcgctcgtcggc
caggagcacgtcgtcagggcgctcacgcacgcgctcgacggcgggcgtttgcatcacgcc
tatttgtttacgggcacgcgcggcgtcggcaagaccacgctgtcccggatcttcgccaag
gcgctcaattgcgagacgggcgtcacctcgcagccgtgcggcgtatgccgtgcctgccgt
gagatcgacgagggccgtttcgtcgactatgtcgaaatggatgcggcgagcaatcgcggt
gtcgacgaaatggccgcgctgctcgagcgcgccgtgtacgcgcccgtggacgcgcgcttc
aaggtctacatgatcgacgaagtccacatgctgacgaaccacgccttcaacgcgatgttg
aagacgctggaagagccgccgccgcacgtcaagttcatccttgccaccaccgatccgcag
aagattcccgtcaccgtcctgtcgcgctgcctgcagttcaatctgaagcagatgccggcc
ggccatatcgtgatgcatctcgagcgcattctgggcgaggagcgcgtcgcgttcgagcca
caggcgctgcggctgctcgcgcgcgcggcacagggcagcatgcgcgatgcgctgtcgttg
accgatcaggcgatcgcctattcggccaacgaggtgaccgaggcggccgtgtcgggaatg
ctcggcgcgctggaccagacctacatggtccggttgctcgacgcgatcgcctcgtccgac
ggccccgaaatcctcgcgatcgccgacgagatggccttgcgcagcctgtcgttctcgacc
gcgctgcaggatctggccggcctgctgcaccgcatcgcctgggcgcagttcgcaccggcc
tcggtgctcgacgagtggcccgaggcggccgacctgcgccgcttcgccgaggcgctgagc
ccggagcaggtgcaactctattaccagatcgcgacggtcggccggggcgaactcggcctc
gcgcccgacgaatatgcgggtttcacgatgacgctgctgcggatgctggcgttcgcgcca
gccgcgagcggcggcgcgccagtgcctggcgcggcgcctgccgtggccgccggcggccgt
cgcgcggccgcgccggtggcgccggccggagccggcgcgcgcgatgccgcagcgcatgcg
atgccacccgtggccgccgcggcgtctgcaaggcccgcgcccgccccggtggcgcaggct
gcggccgagccgccgcccgcggccgtcgccgcaccgcgcgcggtgccgccagcggcggcc
cgcgatgtcgcgacagcgaagcggccggccgagttgccggtgcgcgccgagcaagcgagg
cccgccgaatcggacgaggcggccgctgtcgcgccgcgcgaatcggcgccggacctcgcg
gacgagcctgccgagtcgccgcttgcctcgcagctcgaatcatccgatgtcgcgctcggc
gccgggccgacgccgcccgctgaaccggcggccatgctcgagccgtcgctgcgcgccgac
acgccgccgatggccgagtctgcggccgaagccgcgtttgccgaagacgtctcgtccttg
cccgccgccttgccgcaagcatctccgccgtcggctgacgccgcgccgcttgccgccgcg
ccgcgtcccgatcgggtcgagcctgccgcggtccggcctccggccgcgccggttgccgcg
ccgggcgaacgttccgacgcgctgcgcggcgggggcgccgccgccgcgctcgacgtactg
cgcaacgccggcatgcgcgtctcgtccgatcgcggccgcgcagcctcggccgccaagccg
gcgccggcggccaagtccgccgcgccgcgcgtgaacgtgccgaccccgcgcccgcgcacg
gcgcagccgtcccgtcccgccgccgcggccgatccgtcggcgccgccgccgtgggatgac
atgccgcccgacgattacctgccgatctcggccgacgaccactacgggccaccgcccgac
gacggctaccttcccgtcttcgacagcagtcccgacgacgtgcgcgtcgcgccgcagccg
gcgcccgcaccggctgacacccgaccgctgccgcccgccatcgcgctcgacgcgatcggc
tatgccggcgaatggccgcaactggccgcgaccctgacgctcaagggcgtcgcttaccag
ctcgcgttcaacagcgaactgatttccgctcagggcggcgtgctgaagctggccgtgccg
gtgccgcagtatgccgacgcggcgcaggtggtgaagctgaagacggcgcttgccgaggcg
ctcggcaagccggtcgaggtggccgtcgaggtcggtcccgcgcggcgcacggcggccgcg
ctcgatgcggtcgagcgcgcgaagcgccagcgcgaggccgagcaggagatcggcgccgat
ccgttcgtccagcaactgattcgcgacttcggcgcgcgtatcgtcgagggctcggtgcgg
cccgtcgcgagcgacgccgcagcggccgggccggccgggcagtgcggcgcgcccacgctg
cattga

DBGET integrated database retrieval system