KEGG   Burkholderia glumae BGR1: bglu_1g19940Help
Entry
bglu_1g19940      CDS       T00905                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00020  Citrate cycle (TCA cycle)
bgl00310  Lysine degradation
bgl00380  Tryptophan metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Module
bgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bglu_1g19940
  09105 Amino acid metabolism
   00310 Lysine degradation
    bglu_1g19940
   00380 Tryptophan metabolism
    bglu_1g19940
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     bglu_1g19940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N DUF2680
Motif
Other DBs
NCBI-ProteinID: ACR29103
UniProt: C5AGZ6
LinkDB All DBs
Position
1:complement(2180491..2183358)
Genome map
AA seq 955 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSNASD
VAHNPIVESFAQRAKANAFIPRESSGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKR
RERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKSLRDTYCGTIGAEYMY
IGDPEQKRWWQERLESTRATPNFSAEKKKHVLNRLTAAEGLERYLHTKYVGQKRFSLEGG
ESFIAAMDEVVQHSGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPA
GDVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPV
QIHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVV
KMIEAPVLHVNGDDPEAVVLAVQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPL
MYKKIAQHPGTRALYAEKLVQQGVITAEQADEFVKAYRKAMEDGHHTVDPVLSNYKSKYA
VDWVPFLNRKWTDAADTAVPLAELKRIGERITTVPENFKVHPLVERVINDRRKMAQGDQP
LDWGMGEHLAFASLVSSGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNVS
DGQANFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEV
KWGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMI
RLFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVIGETDETIDAKKVKRVIACSGRVY
YDIVAHRREAKANDVAIVRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYI
EHHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcctatctgttcggcggcaatgcttcg
tatgtagaagaactgtacgaagcctatctggacaatccggcatcggtgccggacaactgg
cgcgaatatttcgacgcgctgcaaaacgtgccggcgacggacggttcgaatgcgagcgat
gtcgctcacaatccgatcgtcgaatcgttcgcccagcgtgcgaaggccaatgccttcatc
ccgcgtgaaagcagcggcggcaatctcgccaccgcccgcaagcaggtccacgtccagtcc
ctgatcagcgcgtatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgc
cgcgagcgtcccgcgatccccgagctcgaacccgcgttctacgatttctccgaagccgac
ctcgaccagacgttcagcgcgagcaacctgtatttcggtttcgagcaggcctcgctgcgt
gacatcgtcaagtcgctgcgcgacacctactgcggcacgatcggcgccgagtacatgtac
atcggcgacccggagcagaagcgctggtggcaggagcgtctcgaatcgacgcgcgccacg
ccgaacttcagcgcggagaagaagaagcacgtgctgaaccgtctgaccgccgccgaaggc
ctcgaacgctacctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggc
gagagcttcatcgcggcgatggacgaagtggtgcagcactcgggatcgaagggcgtgcag
gagatcgtgatcggcatggcccaccgcggccgcctgaacgtgctcgtcaacacgctcggc
aagatgccggcggacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggcc
ggcgacgtcaagtatcacaagggtttctcgtcggacattgcgaccgaaggcggtccggtc
cacctgtcgctcgcattcaatccgtcgcacctcgaaatcgtcaatccggtggtcgagggt
tcggccaaggcgcgcatggaccgtcgcggcgacgcggacggcctgcaggtgctgccggtg
cagatccacggcgatgccgccttcgcgggccagggcgtcgtgatggaaacgctgaacctc
gcgcagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatc
ggcttcacgacctcggacccgcgcgatgcgcgctcgacgctgtactgcaccgacgtggtc
aagatgatcgaggcgccggtgctgcatgtgaacggcgacgatccggaggcggtggtgctc
gcggtgcagatcgcgatcgactatcgcatgcagttccacaaggatgtcgtgatcgacatc
gtctgcttccgcaagctcggccacaacgagcaggacacgccggccgtcacccagccgctg
atgtacaagaagatcgcgcagcacccgggcacccgcgcgctgtacgccgagaagctggtg
cagcagggcgtgatcaccgccgagcaggccgacgaattcgtcaaggcctatcgcaaggcg
atggaagacggccaccatacggtcgatccggtgctctcgaactacaagagcaagtacgcg
gtcgactgggtgccgttcctgaaccgcaagtggaccgacgcggccgacacggcggtgccg
ctggccgagctcaagcgcatcggcgagcgcatcacgacggtgccggagaacttcaaggtc
cacccgctcgtcgagcgcgtgatcaacgaccgccgcaagatggcgcagggcgaccagccg
ctggactggggcatgggcgagcacctcgcgttcgcctcgctggtttcgtctggctacgcc
gtgcgcctgaccggccaggattcgggccgcggcacgttcacgcaccgccacgcggtgctg
cacgaccagaatcgcgagcgctggaacgacggcacctatgtgccgctgcagaacgtctcg
gacggccaggcgaacttcacggtgatcgactcggtgctgtcggaagaggccgtgctcggc
ttcgagtacggctattcgaccgctgagccgaacacgctggtgctgtgggaagcgcagttc
ggcgacttcgtgaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtg
aagtggggccgcgtctcgggcctgacgatgctgctgccgcacggctatgaaggccagggc
ccggagcactcgtcgacgcgtatcgagcgtttcctgcaactgtgcgcggaccacaacatg
caggtggtccagccgaccacgccggcgcagatcttccacctgctgcgccgccagatgatc
cggctgttccgcaagccgctgatcgtggcgacgccgaagtcgctgctgcgtcacaaggaa
gccgtgtcggacctgtcggaactggcgaagggctcgttccagccggtgatcggcgagacc
gacgagacgatcgacgcgaagaaggtcaagcgcgtgatcgcctgctcgggccgcgtctat
tacgacatcgtcgcgcaccgccgcgaggcgaaggcgaacgacgtcgcgatcgtccggatc
gagcagctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgacaat
gcgaccgaagtggtctgggtgcaggacgagccgcagaatcagggcccgtggttctacatc
gaacaccatctgaaggaaggcatgaaggaagggcagaagctcgcgtatagcggccgcccg
gcttcggcctcgccggcggtcggttactacgcgaagcactacgagcagcagaaggccctg
atcgaaggggcattcggccgcctgaagagcgcgtcgatcgcgaaataa

DBGET integrated database retrieval system