KEGG   Burkholderia glumae BGR1: bglu_1g24410Help
Entry
bglu_1g24410      CDS       T00905                                 

Definition
(GenBank) Tryptophanyl-tRNA synthetase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    bglu_1g24410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgl01007]
    bglu_1g24410
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgl03016]
    bglu_1g24410
Enzymes [BR:bgl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     bglu_1g24410
Amino acid related enzymes [BR:bgl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   bglu_1g24410
Transfer RNA biogenesis [BR:bgl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    bglu_1g24410
 Prokaryotic type
    bglu_1g24410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: ACR29519
UniProt: C5A9T1
LinkDB All DBs
Position
1:complement(2773587..2774789)
Genome map
AA seq 400 aa AA seqDB search
MFPDRIFSGMRPTGSLHLGHYHGVLKNWAKLQSEYPCFFCVVDWHALTTHYETPEVIEKN
VWEVLIDWIAAGIDPTQATLFIQSKVPEHAELALLLGMSTPLGWLERVPTYKEQIEKLRD
KDLSTYGFLGYPVLMAADILLYRGSLVPVGEDQVPHVEMTREIARRFNYLYGREKGFEEK
ALEAAKKLGGKRAKLYHELRNAYQQEGDDEALEQARAMLQESQSLSMSDRERLFGYLEGA
RKIILVEPQALLTAASRMPGLDGGKMSKSYGNTIGLREDAETITKKVRTMPTDPARVRRT
DPGDPEKCPVWQFHLVYSDDTTREWVTQGCKSAGIGCLDCKQPVVEGILREQQPMLERAQ
KYMDDPSLLRAIVADGCDKARKHAVETMRDVRDAMGLSYN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgttccccgatcgtatcttttccggcatgcgtcccaccgggtcgctgcatctcggccat
taccacggcgtgttgaagaattgggcgaagctgcagtccgagtatccgtgcttcttctgc
gtggtcgactggcatgcgctgaccacgcattacgaaacccccgaggtgatcgagaagaac
gtctgggaagtgctgatcgactggatcgccgccggcatcgatccgacccaggccacgctg
ttcatccagagcaaggtgccggagcatgccgaactggcgctgctgctcggcatgagcacg
ccgctgggctggctcgaacgggtgccgacctacaaggagcagatcgagaagctgcgcgac
aaggacctgtccacctacggctttctcggctacccggtgctgatggcagccgacatcctg
ctctatcgcggctcgctcgtgcccgtcggcgaggatcaggtgccgcacgtcgagatgacg
cgtgagatcgcgcgccgcttcaactacctgtacggccgcgagaagggcttcgaggagaag
gcgctcgaggccgcgaagaagctcggcggcaagcgcgccaagctctatcacgagctgcgc
aacgcctatcagcaggaaggcgacgacgaggcgctcgaacaggcacgcgccatgttgcag
gagtcgcagagcctgtcgatgagcgaccgcgagcggctgttcggctatctcgaaggcgcg
cgcaagatcatcctggtcgagccgcaggcgctgctgaccgcggcgtcgcggatgccgggg
ctcgacggcggcaagatgtcgaagtcgtacggcaacacgatcgggctgcgcgaggacgcg
gaaacgatcacgaagaaggtgcgcaccatgccgaccgacccggcccgcgtgcgccgcacc
gatccgggcgatcccgagaaatgcccggtctggcagttccatctcgtctattcggacgac
accacgcgcgaatgggtgacgcaaggctgcaagtcggccggcatcggctgcctcgactgc
aagcagcccgtggtcgagggcatcctgcgcgaacagcagccgatgctcgagcgcgcgcag
aaatacatggacgacccctcgctgctgcgcgcgatcgtggccgacggctgcgacaaggca
cgcaagcacgcggtcgagacgatgcgcgacgtgcgcgacgcgatgggcctgtcctacaac
tga

DBGET integrated database retrieval system