KEGG   Burkholderia glumae BGR1: bglu_1g24800Help
Entry
bglu_1g24800      CDS       T00905                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00010  Glycolysis / Gluconeogenesis
bgl00020  Citrate cycle (TCA cycle)
bgl00620  Pyruvate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Module
bgl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bglu_1g24800
   00020 Citrate cycle (TCA cycle)
    bglu_1g24800
   00620 Pyruvate metabolism
    bglu_1g24800
Enzymes [BR:bgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     bglu_1g24800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACR29557
UniProt: C5A9W9
LinkDB All DBs
Position
1:complement(2814873..2816507)
Genome map
AA seq 544 aa AA seqDB search
MSQAIEVKVPDIGDYKDIPVIEVLVKAGDTVEAEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDTVSEGTLIVVFEGAGDAKAEAPKAEAPQAAAAPAKAEAPKADALAGGGTVEVKV
PDIGDYKDIPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGTVKEIKVKVGDTVS
EGALIVVLESGDAAPAAAPKAQAPKAEAPKAAPAPAAQASAPAPAPAPAPAPAPAASGRA
SHASPSVRKFARELGVDVGRVTGSGPKGRITKEDVTAFVKGVMTGQTAAPAGAAAPAGGG
ELNLLPWPKIDFTKFGPVEAQPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALRV
QLNKENEKSGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLILKQYFHIGFAADTPNGL
VVPVIRDADKKGLVDIAKEMADLSKAARDGKLKPDQMQGGCFSISSLGGIGGTHFTPIVN
APEVAILGLSRSAMKPVWDGKQFVPRLTLPMSLSYDHRVIDGAAAARFNAYLASILGDFR
RVIL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacatccccgtc
atcgaggtgctggtgaaggcgggcgatacggtggaggccgagcaatcgctcgtcacgctc
gagtccgacaaggcgacgatggacgtgccgagcccgtcggccggcacggtcaaggaagtg
aaggtcaaggtgggcgacaccgtgtcggaaggcacgctgatcgtggtgttcgaaggcgcg
ggcgacgccaaggcggaagcgccgaaggccgaggccccgcaagcggcagccgcgccggcc
aaggccgaggcgccgaaggccgacgctttggcgggcggcggcacggtcgaggtcaaggtg
ccggacatcggcgactacaaggacattcccgtcatcgagatcggcgtgaaggtcggcgac
acggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatggacgtg
ccgagcccggcggccggcaccgtcaaggaaatcaaggtcaaggtcggcgacacggtatcc
gaaggcgcgctgatcgtggtgctggaaagtggcgacgccgcgccggctgcggctccgaag
gcgcaagcgccgaaggccgaggcgccgaaggcggcgccggccccggccgcgcaggcttcg
gctccggctccggctccggctccggctccggctccggctccggccgcgtcgggccgagcg
agccatgcttcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtggacgtcggccgc
gtgacgggttcgggtccgaagggccgcatcacgaaggaagacgtgacggcgttcgtgaag
ggcgtgatgacgggccagaccgcggccccggccggcgctgccgcgccggcgggcggcggc
gagctgaacctgctgccgtggccgaagatcgacttcacgaagttcggcccggtcgaggcg
cagccgctgtcgcgcatcaagaagatctcgggcgcgaacttgcaccgcaactgggtcatg
atcccgcacgtcaccaacaacgacgaggcggacatcaccgagctcgaggcgctgcgcgtc
cagctgaacaaggaaaacgagaagtcgggcgtgaagttcacgatgctcgccttcgtcatc
aaggccgtggtcgcggcgctgaagaagttcccgaccttcaacgcgagcctggacggcgac
aacctgatcctcaagcagtacttccacatcgggttcgccgccgatacgccgaacgggctg
gtggtgccggtgatccgcgacgcggacaagaagggcctcgtcgacatcgccaaggaaatg
gccgacctgtcgaaggcggcccgtgacggcaagctcaagcccgaccagatgcagggcggc
tgcttctcgatctcgtcgctgggcggcatcggcggcacgcatttcacgccgatcgtcaac
gcgccggaagtcgcgattctcggtctgtcgcgcagtgcgatgaagccggtctgggacggc
aagcagttcgtgccgcgcctaacgctgccgatgtcgctgtcatacgatcaccgcgtgatc
gacggcgccgcagccgcgcgcttcaacgcttacctggcgtcgatcctcggcgatttccgc
cgcgtgattctttga

DBGET integrated database retrieval system