KEGG   Burkholderia glumae BGR1: bglu_1g27940Help
Entry
bglu_1g27940      CDS       T00905                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00620  Pyruvate metabolism
bgl00680  Methane metabolism
bgl00710  Carbon fixation in photosynthetic organisms
bgl01100  Metabolic pathways
bgl01120  Microbial metabolism in diverse environments
bgl01200  Carbon metabolism
Module
bgl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bglu_1g27940
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bglu_1g27940
   00680 Methane metabolism
    bglu_1g27940
Enzymes [BR:bgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     bglu_1g27940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACR29860
UniProt: C5ABI4
LinkDB All DBs
Position
1:3165924..3169019
Genome map
AA seq 1031 aa AA seqDB search
MKSSGSARAARRNAASSNVTAPATTDAPARQRGTTTAAQPAAQAATTKKPARPAANGDAT
PRKAGPTRPAATPGGTPARTGGATAAERPKPKANGRTRDDKDQPLFEDIRYLGRLLGDVV
REQEGEAVFEVVETIRQHAVKFRREDDREAAQALDKMLRKLTPEQTVSVVRAFSYFSHLA
NIAEDRHHNRRRRIHALAGSAPQAGTVAYALQALKAAGDASAEVIRRFFDEALIVPVLTA
HPTEVQRKSILDAQHDIARLLAERDQELTARERAHNDALLRARVASLWQTRMLRDARLTV
ADEIDNALSYYRATFLHELPALYADIEEALAEHGLAARVPAFFQMGSWIGGDRDGNPNVT
AATLEEAIHRQGAVILEHYLEQVHKLGAELSVSDLLVGASDEVRALAAASPDQSPHRVDE
PYRRALIGIYTRIAASARVRLGEGVVAVRSAGRGAPPVRATPYPDAEAFASDLRVLQDSL
VAHHGALLATPRLAPLVRAAETFGFHLASIDLRQSSDIHEAVIAELLARAGVEADYAALP
EADKLRVLLAALADPRPLRIPYVDYSELANSELGVLEKAREVRARFGPRAVRNYIISHTE
TVSDLVEVLLLQKETGLLDGTFGAGAADAKHSLMVIPLFETIADLRNAPEIMGDYFALPG
AAALVARQGGEQEVMLGYSDSNKDGGFLTSNWELYRAELALVELFRAHGIRLRLFHGRGG
TVGRGGGPTYEAILSQPPGTVNGQIRLTEQGEVIASKFSNPEIGRRNLETVVAATLEASL
LPRNNAPAQLPAFEAAVQTLSDVAIATYRALVYETPGFTDYFFSSTPINEIAELNIGSRP
ASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAFAAYLDGAGDEAERARRLA
LLQKMNRTWPFFSHLLSNMDMVLSKVDLAVASRYAELVADKKLRKHVFGRIVAEWERTTA
ALAAITGHEARLATNPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARVRRGIHLTI
NGIAAGLRNTG
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctccggatcggcgcgcgctgcgcgccgcaatgctgcctcgtccaacgtcacc
gcgccggccacgaccgacgcccccgcgcgccagcgcggcacgaccacggccgcccaaccc
gccgcccaggcggcaaccacgaagaaaccggcaagaccggccgccaacggcgacgcgacg
ccccgcaaggccggcccgaccaggccggccgcgacacccggcggaacgccggcgcggacc
ggcggcgcgaccgcggccgagcggccgaagccgaaggccaacggccgcacgcgcgacgac
aaggatcagccgctgttcgaggacatccgctatctgggacgcctgctcggcgacgtggtg
cgcgagcaggaaggcgaggccgtgttcgaggtggtcgagacgatccgccagcacgccgtg
aagttccgccgcgaggacgatcgcgaggccgcgcaggcgctcgacaagatgctgcgcaag
ctcacgcccgagcagaccgtgagcgtggtgcgcgcattcagctacttctcgcatctggcc
aatatcgccgaggaccgccatcacaaccgccgccgccggattcatgcgctggccggctcc
gcgccgcaggcgggcaccgtggcctacgcgctgcaggcgctcaaggcggccggcgacgcg
tcggccgaggtgatccgccgcttcttcgacgaggcgctgatcgtgccggtgctgaccgcg
caccccaccgaagtgcagcgcaagagcatcctcgacgcccagcacgacatcgcgcggttg
ctggccgagcgcgaccaggagctgaccgcgcgcgagcgcgcccacaacgacgcgctgctg
cgcgcgcgggtcgcctcgctgtggcagacccgcatgctgcgcgacgcgcggctgacggtg
gccgacgagatcgacaacgcgctgtcctactaccgcgcgaccttcctgcacgagctgccg
gcgctctacgccgacatcgaggaggcgctcgccgaacacggcctggccgcgcgcgtgccg
gccttcttccagatgggcagctggatcggcggcgaccgcgacggcaatccgaacgtgacg
gccgccacgctcgaggaggcgatccaccgccagggcgccgtgatcctcgagcactacctg
gagcaggtccacaagctcggcgccgagctgtcggtgtcggacctgctggtgggcgcgagc
gacgaggtcagggcgctcgcggccgcctcgcccgaccagtcgccgcatcgcgtcgacgag
ccgtaccgccgcgcgctgatcggcatctacacgcgcatcgccgcgagcgcgcgggtgcgc
ctgggcgaaggcgtggtggcggtgcgcagcgccgggcgcggcgcgccgccggtgcgcgcg
acgccgtatccggacgccgaggcgttcgcgagcgacctgcgcgtgctgcaggactcgctc
gtcgcccatcacggcgcgctgctggcgacgccgcgcctcgcgccgctggtgcgcgcggcc
gagacgttcggcttccatctcgccagcatcgacctgcgccagagctcggacatccacgag
gccgtgatcgccgagctgctcgcgcgcgccggcgtcgaggccgactacgcggcgctgccc
gaagccgacaagctgcgcgtgctgctcgccgcgctggccgacccgcgcccgctgcggatt
ccctacgtcgactactccgagctggcgaacagcgaactcggcgtgctcgagaaggcccgc
gaggtacgcgcgcggttcggcccgcgcgcggtgcgcaactacatcatctcgcataccgag
acggtgtccgacctggtggaggtgctgctgctgcaaaaggagaccggcctgctcgacggc
accttcggcgccggggcggccgacgcgaagcattcgctgatggtgatccccttgttcgag
acgatcgccgacctgcgcaacgcgcccgagatcatgggcgactacttcgcgctgccgggc
gccgcggcgctcgtcgcgcgccagggcggggagcaggaggtgatgctcggctactcggac
agcaacaaggacggcggcttcctgacctcgaactgggagctgtaccgcgccgagctcgcg
ctggtcgagctgttccgcgcgcatggcatcaggctgcggctgttccatggccgcggcggc
acggtcggccgcggcggcggccccacctacgaggcgatcctctcgcagccgcccggcacc
gtgaacggccagatccgcctgaccgagcagggcgaggtgatcgcgagcaagttctcgaac
cccgagatcggccgccgcaacctcgaaacggtggtcgccgcgacgctcgaggcctcgctg
ctgccgcgcaacaacgcgcccgcgcagctgccggcgttcgaggccgccgtgcagacgctg
tcggacgtggcgatcgccacctatcgcgcgctcgtctacgagacgcccggcttcaccgat
tatttcttctcctcgacgccgatcaacgagatcgccgagctgaacatcggcagccggccg
gcctcgcgcaagctgcaggacccgaagcaccgcaagatcgaggacctgcgtgcgatcccg
tggggcttctcgtggggccagtgccggctgctgctgaccggctggtacggcttcggcagc
gccttcgcggcctacctcgacggcgccggggacgaagccgagcgcgccaggcgcctcgcg
ctgctgcagaagatgaaccgcacctggccgttcttctcgcacctgctctcgaacatggac
atggtgctctccaaggtcgatctggcggtggcctcgcgctatgcggaactcgtcgccgac
aagaagctgcgcaagcacgtgttcggccgcatcgtcgccgaatgggagcgcaccacggcc
gcgctcgccgcgatcaccggccacgaggcgcggctcgccaccaacccgctgctggcgcgc
tcgatcaagaaccgcttcccctacctcgatccgctgaaccacctgcaggtcgaactgatc
aagcgccaccgcgccggtgacaccaacgcgcgcgtgcggcgcgggatccatctgaccatc
aacggcatcgcggccggcctgcgcaataccggctga

DBGET integrated database retrieval system