KEGG   Burkholderia glumae BGR1: bglu_1g33440Help
Entry
bglu_1g33440      CDS       T00905                                 

Definition
(GenBank) Putative amino-acid transporter transmembrane protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    bglu_1g33440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: ACR30406
UniProt: C5AEK0
LinkDB All DBs
Position
1:3803241..3804641
Genome map
AA seq 466 aa AA seqDB search
MSLLRKKNVDQMIAGAQRAGLKKALGALDLTFLGIGAIIGTGIFVLTGTGAVQAGPALMV
SFVVAAIACGLSALAYAEFASTIPVAGSIYTYSYATLGELVAWIIGWDLMLEYSLAASAV
SVGWSGYLQSLLKGFGVVLPAVLTAAPGSVPGVTTYFDLPAFAVMLAITALLSVGIREST
RVNNIMVFIKIAVVLLVIAVGVFHVTPANWTPFMPHGWQGVFGAAAVMFFAFIGFDAVSS
AAEEVKNPKRDLPVGIIASLGVCAVLYVAVAAVATGIVPSAQYAGITHPISYALQVAGQK
WVAGFIDLGAVLGMLTVILVMTYGQTRITYAMSRDGLLPAVLSRVHPRFQTPFVATWIIG
LLCALIAALIPLNVLAELINIGTLAAFSMVSIAVIVLRRTRPDLPRAFRCPGVPTVPILA
VAACLFLMLNLNAVTWKAFLIWLAIGLIVYFAYSRRHAKVAHGEAH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcttcgcaagaaaaacgtcgaccagatgatcgccggcgcgcagcgcgcgggg
ctcaagaaggcgctcggcgccctcgatctgaccttcctcggaatcggcgccatcatcggc
accgggatcttcgtgctgaccggcacgggcgccgtgcaggccggcccggcgctgatggtg
tcgttcgtcgtcgcggcgatcgcgtgcgggctgtccgcgctcgcctacgccgagttcgcc
tcgacgattccggtggccggctcgatctacacctattcgtatgccacgctcggcgagctg
gtggcctggatcatcggctgggatctgatgctcgaatacagcctcgcggcatcggccgtc
tcggtgggctggtcgggctacctgcaatcgctgctgaagggcttcggcgtggtgctgccg
gccgtgctcaccgcggcgcccggttcggtgcccggcgtgaccacctatttcgacctgccg
gccttcgcggtgatgctcgcgatcaccgcgctgctgtcggtcggcatccgcgaatcgacg
cgcgtgaacaacatcatggtgttcatcaagatcgccgtggtgctgctggtgatcgcggtg
ggcgtgttccacgtgacgccggccaactggacgccgttcatgccgcacggctggcagggc
gtgttcggcgccgcggccgtgatgttcttcgcgttcatcggcttcgacgcggtgtcctcg
gcggccgaggaagtgaagaatccgaagcgcgacctgccggtcggcatcatcgcctcgctc
ggcgtctgcgcggtgctgtacgtggccgtcgcggcggtggccaccggcatcgtgccgtcg
gcccagtacgcgggcatcacccatccgatctcgtatgcgctgcaggtggccggccagaag
tgggtggccggcttcatcgacctgggcgccgtgctcggcatgctgaccgtgatcctcgtg
atgacctacggccagacccgcatcacctacgcgatgtcgcgcgacgggctgctgcccgcg
gtgctctcgcgcgtgcatccgcgcttccagacgccgttcgtcgccacctggatcatcggt
ctgttgtgcgcgctgatcgccgcgctgatcccgctcaacgtgctggccgagctgatcaac
atcggcacgctggccgcgttctcgatggtgtcgatcgccgtgatcgtgctgcgccgcacg
cgtccggacctgccgcgcgcgttccgctgcccgggcgtgccgacggtgccgatcctggcg
gtcgccgcgtgcctgttcctgatgctgaacctgaacgccgtcacctggaaggcgttcctc
atctggctcgcgatcggcctgatcgtctatttcgcctactcgcgtcgccacgcgaaggtc
gcgcacggcgaggcccactga

DBGET integrated database retrieval system