KEGG   Burkholderia glumae BGR1: bglu_2g03380Help
Entry
bglu_2g03380      CDS       T00905                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00250  Alanine, aspartate and glutamate metabolism
bgl00410  beta-Alanine metabolism
bgl00640  Propanoate metabolism
bgl00650  Butanoate metabolism
bgl01100  Metabolic pathways
bgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    bglu_2g03380
   00650 Butanoate metabolism
    bglu_2g03380
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bglu_2g03380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bglu_2g03380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgl01007]
    bglu_2g03380
Enzymes [BR:bgl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     bglu_2g03380
Amino acid related enzymes [BR:bgl01007]
 Aminotransferase (transaminase)
  Class III
   bglu_2g03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACR30799
UniProt: C5ALU8
LinkDB All DBs
Position
2:complement(399954..401237)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVMNTGHRHPK
LVKAIAAQLEQFTHTAYQIVPYASYVELAEKIIARAPGSFAKKAAFFTTGAEAVENAVKM
ARAFTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNPLHGVSVA
ASLKAIDLLFKADIDPKRVAAIIFEPVQGEGGFYAAPADFVRGLRKICDEHGIVLIADEV
QTGFARTGKLFAMQHHDVLPDLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEERLEARAVTLGDKLKARLAALQPEVPQIADVRGPGAMVAVEFFK
AGTQEPDADFTKRVQARALERGLLLLICGVHSNVIRFLFPLTIPDAVFDEALGILDTVLK
ETVGVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgatctgcaagcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgacttctatgccgcgcgcgccgagaacgccgagctgtgggacgtggagggccgc
cgcttcatcgatttcgcggccggcatcgcggtgatgaacaccggccaccgccacccgaag
ctcgtcaaggcgatcgccgcgcagctcgagcaattcacgcacacggcctaccagatcgtt
ccctacgcgtcctacgtcgaactggccgagaagatcatcgcgcgcgcgccgggcagcttc
gcgaagaaggccgcgttcttcaccacgggcgccgaggccgtcgagaacgccgtcaagatg
gcgcgcgccttcaccggccgccccggcgtgatcgcgttcgcgggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctcaatttcgggccg
ttcccgggcgacgtgttccacgcgccctacccgaacccgctgcacggcgtgagcgtggcc
gcctcgctgaaggcgatcgacctgctgttcaaggccgacatcgatccgaagcgcgtggcg
gcgatcatcttcgagccggtgcagggcgaaggcggcttctacgcggcaccggccgatttc
gtgcgcggcctgcgcaagatctgcgacgagcacggcatcgtgctgatcgccgacgaggtg
cagaccggcttcgcgcgcaccggcaagctgttcgcgatgcagcaccacgacgtgctgccc
gacctcatcaccatggccaagagcctcgcgggcggcatgccgctgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggccgcgccgggcggcctcggcggcacctacgcgggcaat
ccgctcgcggtggccgccgcgcacgcggtgctcgacatcatcgacgaggaacggctcgaa
gcgcgcgccgtcacgctcggcgacaagctcaaggcgcggctcgccgcgctgcagcccgag
gtgccgcagatcgccgacgtgcgcggcccgggcgccatggtggccgtcgagttcttcaag
gccggcacgcaggagccggacgcggacttcaccaagcgcgtgcaggcgcgcgcgctcgaa
cgcggcctgctgctgctgatctgcggcgtccactcgaacgtgatccgcttcctgttcccg
ctgacgatcccggacgccgtgttcgacgaagcgctcggcatcctcgacaccgtgctgaag
gaaaccgtcggcgtcgccgcctga

DBGET integrated database retrieval system