KEGG   Burkholderia glumae BGR1: bglu_2g08250Help
Entry
bglu_2g08250      CDS       T00905                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00020  Citrate cycle (TCA cycle)
bgl00190  Oxidative phosphorylation
bgl00650  Butanoate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Module
bgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bglu_2g08250
   00650 Butanoate metabolism
    bglu_2g08250
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    bglu_2g08250
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     bglu_2g08250
    1.3.5.4  fumarate reductase (quinol)
     bglu_2g08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 DAO Thi4 GIDA HI0933_like Lycopene_cycl Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACR31240
UniProt: C5AH60
LinkDB All DBs
Position
2:1003204..1004979
Genome map
AA seq 591 aa AA seqDB search
MAAINTSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARAGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTPRGHEEPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKQQREHKPLPKDAADFSLARLAKLDSSSSGEYAQSVANEIRGSMQKHAGVFRTS
ALLAEGVQDIKKLAERAQHIHLKDKSKVFNTARVEALEVANLVEAARATMVSAEARKESR
GAHAQDDYPQRDDENWMRHTLWFSEGDRLDYKPVHMQPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaacacttccctgccgcgtcgcaagttcgacgtggtcatcgtcggcgcg
ggcggctcggggatgcgcgcatcgctgcaactcgcgcgcgcgggcctgtcggtctgcgtg
ctctcgaaagtgtttccgacgcgttcgcacacggttgccgcccagggcgggatcggcgcc
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgaattcatgtgccgtgaagcacccaacgcc
gtctacgagctcgagcacttcggcatgccgttcgaccgcaacgcggacggcaccatctac
cagcgcccgttcggcggccataccgcgaactacggcgagaagccggtgcagcgcgcctgc
gcggcggccgaccgtaccggccacgcgctgctgcacacgctgtatcagcagaacgtcgcg
gccaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgaccgccctcgaaatggaaacgggcgacgtctacatcctcgaaggc
aagaccacgctgttcgccacgggcggcgccggccgcatcttcgcggcctcgaccaatgcg
ttcatcaacaccggcgacggcctcgggatggccgcgcgcgccggcatcgcgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcaccgag
ggcgtgcgcggcgaaggcggcatcctgcgcaactcggacggcgagcgcttcatggagcgc
tatgcgccgacgctgaaggatctggcgccgcgcgacttcgtctcgcgctcgatggaccag
gaaatcaaggaaggccgcggggtcggtccgaacaaggaccacgtgctgctcgacctgtcg
cacatcggtgccgagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggagccgatcccggtcgtgccgaccatccactaccag
atgggcggcatcccgaccaacatccacggccaggtcgtcggcacgccgcgcggccacgaa
gagcccgtcaacggcttctatgccgtgggcgagtgctcgtgcgtgtcggtgcacggcgcc
aaccgcctgggcacgaactcgctgctcgacctggtggtgttcggccgcgcagccggcaac
cacatcgtcgaacacgtcaagcagcagcgcgagcacaagccgctgccgaaggacgcggcc
gacttctcgcttgcgcgtctggccaagctcgacagctcgagttcgggcgagtacgcgcaa
agcgtcgccaacgagattcgcggctcgatgcagaagcatgccggcgtgttccgcacctcg
gcgctgctggccgaaggcgtgcaggacatcaagaagctcgcggaacgtgcccagcacatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgaagtggcg
aacctggtcgaagcggcgcgcgccaccatggtgtcggccgaagcccgcaaggaaagccgc
ggcgcgcacgcgcaggacgactacccgcaacgcgacgacgaaaactggatgcgtcatacg
ctgtggttcagcgaaggcgatcgtctcgactacaagccggtgcacatgcagccgctgacg
gtcgaatccgtgccgcccaaggcgcgtacgttctaa

DBGET integrated database retrieval system