KEGG   Burkholderia glumae BGR1: bglu_2g08260Help
Entry
bglu_2g08260      CDS       T00905                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00020  Citrate cycle (TCA cycle)
bgl00190  Oxidative phosphorylation
bgl00650  Butanoate metabolism
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
bgl01130  Biosynthesis of antibiotics
bgl01200  Carbon metabolism
Module
bgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bglu_2g08260
   00650 Butanoate metabolism
    bglu_2g08260
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    bglu_2g08260
Enzymes [BR:bgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     bglu_2g08260
    1.3.5.4  fumarate reductase (quinol)
     bglu_2g08260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ACR31241
UniProt: C5AH61
LinkDB All DBs
Position
2:1005001..1005702
Genome map
AA seq 233 aa AA seqDB search
MAKRIFELYRYDPDKDAAPRMQTYEVELKHERMLLDALVKLKEIDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPERIVLRPLPGLPVVRDLIVDMTQFFNQYHSIKPFLING
TPPPEKERLQSPEEREELDGVYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDEATAERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcattttcgaactctatcgttacgatccggacaaggacgcggcgccgcgc
atgcagacgtacgaagtcgagctcaagcatgaacgcatgctgctcgacgcgctggtcaag
ctgaaggaaatcgacgagacgctgtcgttccgtcgctcgtgccgcgagggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggtctggcgtgcctcacgaacctgaacgac
ctgcccgagaggatcgtgctgcgtccgctgccgggcctgccggtggtgcgcgacctgatc
gtcgacatgacgcagttcttcaaccagtaccactcgatcaagccgttcctgatcaacggc
acgccgccgcccgagaaggagcgcctgcagtcgccggaagagcgcgaggagctggacggc
gtgtacgagtgcatcctgtgcgcgagctgctcgacctcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggccggcctgctccaggcttaccgcttcatcgccgacagc
cgcgacgaggccaccgccgaacgcctcgacaacctcgaggacccgtaccgtctgttccgt
tgccacacgatcatgaactgcgtcgacgtttgcccgaaggggctgaacccgaccaaggcg
atcggcaagatcaaggaattgatggttcgccgcgcggtctga

DBGET integrated database retrieval system