KEGG   Burkholderia glumae BGR1: bglu_2g11450Help
Entry
bglu_2g11450      CDS       T00905                                 

Definition
(GenBank) Anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgl00405  Phenazine biosynthesis
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01130  Biosynthesis of antibiotics
bgl01230  Biosynthesis of amino acids
bgl02024  Quorum sensing
Module
bgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bglu_2g11450
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    bglu_2g11450
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    bglu_2g11450
Enzymes [BR:bgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     bglu_2g11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACR31536
UniProt: C5AI06
LinkDB All DBs
Position
2:complement(1455766..1457310)
Genome map
AA seq 514 aa AA seqDB search
MLSQDEFTRYGEAGFNLVPLWKVLPLPERLDPLDVYRALANRRDDYLFETGEWENAAFTR
HYSTIGLPCGERIELDEDAIRHLRHGRVQSEQRTDDPLAALRRLQEGFRVPHFDSLPPFS
GGLFGYFGFETTRLIEPRLRRTARKPSGLQVPDVVQLVSRELVVIDHRRRQLFCIVHEDP
SEAGSHARGLARLEAMAAQLGAIAPARAREPGTTRGLAVDASRLSFGFAREAYEGAVDRI
KDYIAAGEVMQVVLAQRMSRPLACDAIALYRALGDLAQTPYRYLVNLGECAIVGASPEML
VQQRGDIVTSRPMAGTRRRTQDDAEDARLKQELLADPKEIAEHMMLVDLARNDVGRLAVP
GGVQVDELLTVEYFSHVMHIVSTVTGKLPGQVHGIDVLRSTFPAGTLSGASKVRALEVIA
ELEPHSRGIYGGAVGYLDWRGQAELAITIRTGVLQGGLLHVQSGAGVVKDSVAEREWQET
MDKSRMMLLAAELAERQSETARSGAAQQEATACI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccaggatgagtttacgcggtacggcgaggcggggttcaacctcgtgccgctc
tggaaggtgctgccgctgcccgagcggctcgatccgctggacgtctatcgcgcgctcgcg
aaccggcgcgacgactacctgttcgagaccggcgagtgggagaacgcggcgtttacgcgc
cactactcgaccatcggcctgccctgcggcgagcgcatcgagctggacgaggatgcgatc
cgccatctgcgccacggccgcgtgcagagcgagcagcgcaccgacgatccgctcgccgcg
ctgcgccgcctgcaggaaggctttcgcgtgccgcacttcgacagcctgccgccgttctcg
ggcggcctgttcggctacttcggcttcgagaccacgcgtctgatcgagccgcgcctgcgc
cgcacggcgcgcaagccctcgggcctgcaggtccccgacgtggtgcagctggtgagccgc
gagctggtggtgatcgaccatcgccgccgccagctgttctgcatcgttcacgaggatccg
tccgaggccggcagccacgcgcgcggcctggcacggctggaggcgatggccgcgcagttg
ggcgcgatcgccccggcgcgcgcgcgcgagcccggcaccacccggggcctcgccgtcgac
gcgagccggctgtcgttcggcttcgcgcgcgaagcctacgaaggcgccgtcgaccgcatc
aaggactacatcgccgccggcgaagtgatgcaggtggtgctcgcgcagcgcatgagccgc
ccgctcgcctgcgatgccatcgcgctctaccgcgcgctcggcgatctcgcgcagacgccg
taccgctacctggtcaacctcggcgaatgcgcgatcgtgggcgcctcgcccgagatgctg
gtgcagcagcgcggcgacatcgtcacgagccgtccgatggccggcacgcgccgccgcacc
caggacgatgccgaggacgcgcgcctgaagcaggaactgctggccgatccgaaggagatc
gccgagcacatgatgctggtcgatctcgcgcgcaacgacgtgggccgtctggccgtgccc
ggcggcgtgcaggtggacgagctgctgacggtcgaatatttctcgcacgtcatgcacatc
gtctcgaccgtcaccggcaagctgcccgggcaggtccacgggatcgacgtgctgcgcagc
acgttcccggccggcacgctgagcggcgcctcgaaggtgcgtgcgctggaagtgatcgcc
gagctcgagccgcactcgcgcggcatctacggcggcgcggtcggctatctcgactggcgc
ggccaggccgagctggccatcacgattcgcaccggcgtgctgcagggcgggctgctgcac
gtgcagtcgggcgccggcgtggtgaaggactcggtggccgagcgcgagtggcaggaaacc
atggacaagagccgcatgatgctgctggcggccgagctggcggaacgccagagcgaaacg
gcgcgctccggcgcggcgcaacaggaggcaacggcatgcatctga

DBGET integrated database retrieval system