KEGG   Burkholderia glumae BGR1: bglu_2g13460
Entry
bglu_2g13460      CDS       T00905                                 

Definition
(GenBank) Phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00440  Phosphonate and phosphinate metabolism
bgl00998  Biosynthesis of various secondary metabolites - part 2
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    bglu_2g13460
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    bglu_2g13460
Enzymes [BR:bgl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     bglu_2g13460
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 PEP_hydrolase ICL IspD Ribul_P_3_epim
Other DBs
NCBI-ProteinID: ACR31706
UniProt: C5AIH6
LinkDB
Position
2:1726801..1728486
AA seq 561 aa
MNAREPNFTESRAARLRRMLTSHELEFLMEAHNGLSAKIVREAGFKAIWGSGLSISAALG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFAGKIKAGKDSQHDPDFSIVARVEALIAGWGMDEALRR
AHAYADAGADAILIHSKLSRPDEILQFAREWGNRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLVRSSAAAMQATAREIFESETLVNVEDRVATVNEIFRLQDADEYSAAERLYLSSS
SRASNSALVLAASRGSGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKEGVNDITVVGGYR
ADAIDKSGVKLVVNERHAETGELASLACAVDRINGDTVISYGDLLFRSYILRDLAESDAE
FTVVVDSSLTDSPNQSVRDFALCSAADDRGLFGQKITLQRVASDAGNGAPHGRWIGLLNV
RGAGVERLKATIATLQSRPDFDQLDIPALLNALVEAGEQIAVQYVHGHWRGVNDLDEFRR
AGDFAHGQTPLASGTADGDAQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaatttcaccgaatcccgcgccgcgcggctgcggcgcatgctg
acgagccacgagctcgaattcctgatggaagcgcacaacggcctgtccgcgaagatcgtg
cgcgaggccggcttcaaggcgatctggggctcgggcctgtcgatctccgccgcgctcggc
gtgcgcgacaacaacgaggcgagctggacccaggtggtggacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
atgcgccgcctggtgcgcaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttcgcgggcaagatcaaggccggcaaggattcgcagcacgatccggacttctcg
atcgtggcgcgcgtcgaggcgctgatcgcgggctggggcatggacgaggcgctgcgccgc
gcgcatgcctacgccgacgccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctccagttcgcgcgcgagtggggcaaccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgcccaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggccaaccacctggtgcgctcgtcggccgccgcgatgcaggccaccgcgcgcgag
atcttcgagagcgagacgctcgtcaacgtcgaggatcgcgtggccaccgtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcctctacctgtcgtcgtcg
tcgcgcgcgtcgaactcggcgctggtgctcgcggcgagccgcggctcgggcctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgctgcgctgg
ctggtggacggcttcaagaaggaaggcgtaaacgacatcacggtggtgggcggctaccgc
gccgacgcgatcgacaagtcgggcgtgaagctggtggtcaacgagcgccatgccgaaacg
ggcgagctcgcctcgctggcctgcgcggtcgaccggatcaacggcgacaccgtgatttcc
tacggcgacctgctgttccgcagctacatcctgcgcgacctggccgagagcgacgccgag
ttcacggtggtggtggattcgtcgctgaccgattcgccgaaccagagcgtgcgcgacttc
gcgctgtgctcggccgccgacgaccgcggcctgttcggccagaagatcacgctgcagcgc
gtggcgagcgacgccggcaacggcgcgccgcacggccgctggatcggcctcctgaacgtg
cgcggcgcgggcgtggagcgcctgaaggcgacgatcgcgacgctgcagtcacgccccgac
ttcgaccagctcgacattccggcgctgctcaacgcgctggtggaggccggcgagcagatc
gcggtgcaatacgtgcacggccactggcgcggcgtgaacgacctcgacgaattccgccgc
gcaggcgacttcgcgcacggccagacgccgctcgcgagcggcacggccgacggggacgcg
caatga

DBGET integrated database retrieval system