KEGG   Burkholderia glumae BGR1: bglu_2g14050Help
Entry
bglu_2g14050      CDS       T00905                                 

Definition
(GenBank) permease
  KO
K07090  uncharacterized protein
Organism
bgl  Burkholderia glumae BGR1
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    bglu_2g14050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ACR31764
UniProt: C5AIN4
LinkDB All DBs
Position
2:complement(1795651..1796400)
Genome map
AA seq 249 aa AA seqDB search
MDSSGSTAAMVVAAFALAGLVKGMIGLGLPTVAMALLTLAMPPAAAASLLVVPSLVTNVW
QLAHGPAFGALARRLWPLLAGIVAGTFAGGLPPLAHAAPWTRVALGAVVALYGAWGLAAP
RLPAPGHRERWLAPLAGYLTGAITAATGVFVMPAVPYLQALRLDKAQLVQALGLSFTVST
LALAVQLAFTSGWQPVDLGMSALALVPALAGMAGGTILRNRVGEATFRHAWFAGFVALGL
YMAVGPARG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggattcatcgggttcgacggcggccatggtggtcgccgcattcgcgctggccggcctc
gtgaagggcatgatcgggctcggtctgcccaccgtcgcgatggcgctgctcacgctggcg
atgccgccggccgccgcggcgagcctgctggtggtgccctcgctcgtcaccaacgtctgg
cagctcgcgcacggccccgcgttcggcgcgctggcgcggcgcctgtggccgctgctggcc
gggatcgtcgccggcacgttcgcgggcggcctgccgccgctggcccacgcggccccgtgg
acgcgcgtcgcgctgggagccgtggtcgcgctgtacggcgcgtgggggctggccgcgccg
cgcctgccggcgccggggcaccgcgagcgctggctggcgccgctggccggctacctgacg
ggcgccatcacggccgccaccggcgtgttcgtgatgccggccgtaccgtatctgcaggcg
ctgcgcctcgacaaggcgcaactcgtgcaggcgctcggtctgtcgtttacggtctcgacg
ctcgcgcttgccgtgcaactcgccttcacctcgggatggcagccggtcgatctcggcatg
tcggcgctcgcgctcgtgccggcgctcgccggcatggcgggcgggacgatccttcgcaac
agggtgggcgaagccaccttccggcatgcctggttcgccggattcgtcgcgctcgggctg
tacatggcggtggggccggcgcgcggctga

DBGET integrated database retrieval system