KEGG   Burkholderia glumae BGR1: bglu_2g15560Help
Entry
bglu_2g15560      CDS       T00905                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00500  Starch and sucrose metabolism
bgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bglu_2g15560
Enzymes [BR:bgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     bglu_2g15560
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     bglu_2g15560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ACR31908
UniProt: C5AJ28
LinkDB All DBs
Position
2:1969960..1973415
Genome map
AA seq 1151 aa AA seqDB search
MIREEPLDQLPHAPFQPAAGSPRRGARRAGASRAAGPGAAPADPLWYKDAIIYQLHVKSF
FDSNGDGIGDFPGLISKLDYIASLGVDALWLLPFYPSPRRDDGYDIADYRNVHPDYGTLA
DVRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSVHRDYYVWSDTDTKFAGT
RIIFVDSEPSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQVMRFWLDLGIDGLR
LDAVPYLVEREGTSNENLPETHAILKTIRAAIDAEYPNRMLLAEANQWPEDVQEYFGDED
ECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPELAPSNQWAIFLRNHDELTLEMVTDS
ERDLLWQTYAADRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGM
GDNIHLGDRDGVRTPMQWSADRNGGFSRADPEQLVLPPVMGALYGYDAVNVEAQSRDPHS
LLNWMRRILATRRATQVFGRGTLRFLRPENRKILAYLRELPDATPVLCVANLSRASQAVE
LDLSEFAGCVPVEMTSDSPFPAIGELPYLLTFPPYGFLWFQLSASGAEPAWHRPHAEPLP
EFTTLVMRRGDTHPAAALVATLEAEVLPSWLTRRRWFASKDRALQAVRFECVTPVPGEAF
QYAELVATVDGREDRYAVPLAAAWGDETSHPLFMRLALARVRRGPTVGYLTDAFALPCFA
HGVLRRLADPRDVPLAAGGTLVFSPEPAPALAQYALGDAPEVRWLAAEQSNSSLVIGEAL
VLKLVRRVAPGIHPEAEVSRHLTRAGYRNAPALVGEVRRVAPDGTPHTVAIVQNFVDNQG
DAWARALDFLKRAVSDLALAAAATPEAEAGESAQAALELDTYAAFAGAIGKRLGELHVVL
AAPSDDPAFAPERATPAHVEGWTADALAMFERAAALLAPRLDELDADAREAAAALLASRE
AIAQAIGTLVPRELGATCMRIHGDFHLGQVLEVNGDAMLIDFEGEPARPLAARRAKSHPL
RDVAGLLRSLSYASAAAQFAIEKAPAPTADLKRALFDRFGQAAADRFLASYREACEAAAE
PFVAAEHGERLLMLFLIEKASYELGYEAANRPDWLRVPVVGLASLAAQLLGRPLAAPPRS
PDHPAAPEKKP
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgaagaaccgctcgaccagctgccgcacgctccgttccagcccgccgcgggc
agcccgcggcgcggcgcgcgccgcgccggcgcatcccgtgccgccgggccgggcgccgcg
cccgccgatccgctctggtacaaggacgcgatcatctatcagctgcacgtgaagtcgttc
ttcgattcgaacggcgacggcatcggcgacttccccggcctgatctccaagctcgactac
atcgcctcgctcggcgtggacgcgctgtggctgctgccgttctacccgtcgccgcgccgc
gacgacggctacgacatcgccgactaccgcaacgtccaccccgactacggcacgctcgcc
gacgtgcgccgcttcatccgcgaggcgcacgcgcgcggcatccgcgtgatcaccgagctg
gtgatcaaccacacctcggaccagcacccgtggttccagcgcgcgcgccgcgccaagccc
ggctcggtgcatcgcgactattacgtctggtcggacaccgacaccaagttcgccggcacg
cgcatcatcttcgtcgacagcgagccgtcgaactggacccacgatccggtggcgggccag
tactactggcaccgcttctattcgcaccagccggacctgaacttcgacaatccggcggtg
gtgcgcgaggtgctgcaggtgatgcgcttctggctcgatctcggcatcgacgggctgcgg
ctcgacgcggtgccttacctggtcgagcgcgagggcaccagcaacgagaacctgcccgag
acccacgcgatcctgaagacgatccgcgcggcgatcgacgccgagtatccgaaccggatg
ctgctggccgaggcgaaccagtggcccgaggacgtgcaggaatatttcggcgacgaggac
gaatgccacatggcgttccacttcccgctgatgccgcgcatctacatgtcgatcgccagc
gaggaccgctttccgatcatcgacatcatgcggcagacgccggaactcgcgccgagcaac
cagtgggcgatcttcctgcgcaaccacgacgagctgacgctggagatggtcaccgattcc
gaacgcgacctgctctggcagacctacgccgccgaccgccgcgcgcgcctgaatctcggc
atccgccgccgcctcgcgccgctgatggagcgcgaccggcgccgcatcgagctgatcaac
tcgctgctgctgtcgatgccgggcacgcccgtgatctactacggcgacgagctcggcatg
ggcgacaacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcggcc
gaccgcaacggcggcttctcgcgcgccgatcccgagcagctggtgctgccgcccgtgatg
ggcgcgctgtacggctacgacgcggtgaacgtggaggcgcagtcgcgcgatccgcactcg
ctcctgaactggatgcgccggatcctcgccacgcgccgcgccacccaggtgttcgggcgc
ggcacgctgcgtttcctgcgccccgagaaccgcaagatcctcgcctatctgcgcgagctg
cccgacgccacgccggtgctgtgcgtggccaacctgtcgcgcgcctcgcaggccgtggag
ctggacctgtccgaattcgccggctgcgtgccggtggagatgacgtccgactcgccgttt
ccggcgatcggcgagctgccctatctgctgacctttccgccctacggcttcctctggttc
cagctctcggcgagcggcgcggagccggcctggcaccgcccgcatgccgagccgctgccg
gagttcaccacgctcgtgatgcggcgcggcgatacgcatccggccgcggcgctggtcgcc
acgctggaagccgaggtgctgccgtcgtggctcacgcggcgccgctggttcgcctcgaag
gaccgcgcgctgcaggcggtgcgcttcgagtgcgtcacgccggtgccgggcgaggcgttc
cagtacgccgagctggtggccaccgtcgacggccgcgaggatcgctacgcggtgccgctc
gcggccgcctggggcgacgagacctcgcatccgctgttcatgcgcctggcgctggcgcgc
gtgcggcgcggcccgacggtgggctacctgaccgacgcgttcgcgctgccgtgcttcgcg
cacggcgtgctgcgccggctggcggacccgcgcgacgtgccgctcgccgccggcggcacg
ctggtgttctcgcccgagccggcgccggcgctggcgcagtacgcgctcggcgacgcgccc
gaggtgcgctggctggccgccgagcagagcaacagctcgctcgtgatcggcgaggcgctg
gtgctgaagctggtgcggcgcgtggcgcccggcatccatcccgaggccgaggtcagccgc
catctcacgcgcgccggctaccgcaacgcgccggcgctggtcggcgaggtgcgccgcgtg
gcgcccgacggcacgccgcacacggtcgcgatcgtgcagaacttcgtcgacaaccagggc
gacgcctgggcccgcgcgctcgatttcctcaagcgcgcggtgagcgacctggcgctcgcg
gcggcggccacgcccgaagccgaagccggcgaatcggcgcaggcggcgctcgaactcgac
acctacgccgcgttcgccggcgcgatcggcaagcggctcggcgagctgcacgtggtgctg
gccgcgccgagcgacgatccggcgttcgcgcccgagcgcgccacgccggcccacgtcgag
ggctggaccgccgacgcgctggccatgttcgagcgcgcggccgcgctgctcgcgccgcgc
ctggacgagctcgacgccgacgcgcgcgaggccgcggccgcgctgctcgcctcgcgcgag
gcgatcgcgcaggccatcggcacgctggtgccgcgcgaactgggcgccacctgcatgcgc
attcatggcgacttccatctcggccaggtgctggaggtcaacggcgacgcgatgctgatc
gatttcgagggcgagccggcccggccgctcgcggcacgccgcgccaagtcgcatccgctg
cgcgacgtggccgggctgctgcgctcgctgtcgtatgcgagcgcggccgcgcagttcgcg
atcgagaaggcgcccgcgccgaccgccgacctcaagcgcgcgctgttcgaccgcttcggg
caggccgcggcggaccgctttctcgccagctatcgcgaggcctgcgaagccgcggccgag
ccgttcgtggcagccgagcatggcgagcggctgctgatgctgttcctgatcgagaaggcg
tcctacgagctcggctacgaagccgcgaaccgcccggactggctgcgcgtgccggtggtc
gggctcgcctcgctggccgcgcagctgctcgggcgcccgcttgccgctcccccccgttca
cccgatcacccagctgcaccggagaaaaaaccatga

DBGET integrated database retrieval system