KEGG   Bordetella genomosp. 13: CAL15_03190
Entry
CAL15_03190       CDS       T05441                                 

Definition
(GenBank) integrating conjugative element protein
Organism
bgm  Bordetella genomosp. 13
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: ARP93467
UniProt: A0A1W6Z822
LinkDB
Position
complement(693670..694203)
AA seq 177 aa
MNHIVLIAAIGLLSTTTVFAQTASAPLIVVEDRGGASALPYYQPLNPQPDDTARPAPLPR
PRVGNSAEAEVAMLPVRSANLSPGDVPRRVIRAPGLTPLFLVGDDTRSRAWLRQRHATLR
ELGAVGLVVNVESTAALVELRHLAPGLTLAPASGDDLAQRLGLRHYPVLITSTGVEQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaccacattgtcctcatcgccgccatcgggctgctgtccacgaccaccgtcttcgcc
cagaccgcctccgcgccactgatcgtggtcgaggaccgcggcggcgcgtccgcactgccg
tactaccagcccttgaatccgcagccggacgacaccgcgcggccagccccgctgccacgc
ccgcgcgtgggcaactcggccgaggccgaagtcgcgatgctgccagtgcgctcggcgaac
ctgtcaccgggtgacgtgccgcgccgcgtgatccgcgcgccgggcctgacgccgctgttc
ctggtcggcgacgacacacgctcgcgcgcttggctgcggcagcgccacgccacgttgcga
gagctgggcgccgtgggcctggtggtcaacgtggagtcgacggcggcgctggtcgagctg
cgccacctggcgcccggcctgaccctcgcgccggcctcgggcgacgacctggcccagcgc
ctgggcctgcgccactacccggtgctcatcacgtccaccggcgtcgagcagtag

DBGET integrated database retrieval system