KEGG   Bordetella genomosp. 13: CAL15_14210Help
Entry
CAL15_14210       CDS       T05441                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00564  Glycerophospholipid metabolism
bgm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CAL15_14210
Enzymes [BR:bgm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CAL15_14210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 NAD_binding_8 GIDA FAD_binding_3 Pyr_redox Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ARP97453
UniProt: A0A1W6ZJ63
LinkDB All DBs
Position
3177466..3179061
Genome map
AA seq 531 aa AA seqDB search
MKPASIAPTADRAALLASLPDTEWDIVVIGGGATGLGTAVDAAARGYRTLLIEAADFAKG
TSSRATKLVHGGVRYLAQGNIALVREALHERGLLARNAPHLTWPLGFVVPAYGLFDQPFY
GAGLKVYDMLAGQSNLAPSRWLTRRETLERAATLSTMVGGRTLRGGVLYYDGQFDDARLA
LALMRTLQDLGGTAVNYLRASGLTRKGGRLDGVVLRDALGDASFAVRSRCVINAAGVWVD
AVRRLDDASATGMVAPSQGVHLTLPRDFLPGREAILIPKTDDGRVLFVVPWNGHTLVGTT
DTPRNDLPLEPRAENRDVDFILQTAARYLSRKPTRADVTSVWAGLRPLVRATGDAATKTL
SREHTIALSPSGLLTVTGGKWTTYRRMAQDVLNTAVANQLLPAAHCRTETLRLHGAPDDG
VASGVPPGTPDAYYGTDLPALRALPGADRMLAPATGLSEAHVRYAVRYEMARTVEDVLAR
RNRALFLDVEAALLAAPEVARVMGEELSLDAAWQQREVAAFGELAAQYRLE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcctccatcgcacccaccgccgaccgtgccgccctgctggccagcctgccc
gacaccgagtgggacatcgtcgtgatcggcggcggcgccaccgggctgggcacggcggtg
gacgcggcggcgcgcggctaccgcacgctgctgatagaggcggcggacttcgcgaagggc
acctccagccgtgcgaccaagctggtgcacggcggcgtgcgatatctggcgcaaggcaac
atcgcgctggtgcgcgaggccctgcacgaacgcggactgctggcgcgcaacgcgccgcac
ctgacctggccgctgggcttcgtggtgcccgcctacgggctgttcgaccagcccttctac
ggcgcgggcctgaaggtctacgacatgctggccggccagtcgaacctggcgcccagccgc
tggctgacacgacgcgagaccctggaacgcgcggccaccctgtcgaccatggtaggcggc
cgcacgctgcgcggcggcgtgctgtattacgacggccagttcgacgatgcccgcctggcg
ctcgccctgatgcgcaccttgcaagacctgggcggaacggcggtgaactacctacgcgcc
agcggccttacacgcaagggcggccgcctcgacggcgtggtgctgcgggatgcgctgggc
gatgcgtccttcgcggtccgctcgcgctgcgtgatcaacgccgcgggcgtgtgggtcgac
gcggtgcgccgcctggacgacgcgtcggccaccggcatggtggcgcccagccagggcgtg
cacctgaccctgccgcgcgacttcctgcccggcagggaagccatcctcatccccaagacc
gacgatggccgcgtgctgttcgtggtgccctggaacggccacactctggtcggcaccacc
gacacgccgcgcaacgacctgccgctggagccgcgcgccgagaaccgcgacgtcgatttc
atcctgcagaccgcggcgcgctacctcagccgcaagcccacgcgcgccgacgtcaccagc
gtatgggccggcctgcgcccgctggtccgcgccaccggcgacgccgccaccaagaccctg
tcgcgcgagcacaccatcgcgctgtcgccctcggggctgcttaccgtgaccggcggcaag
tggaccacctatcgccgcatggcgcaggacgtgctgaacaccgcggtggcgaaccagctg
ctgccggcggcgcactgccgcaccgaaacgctgcggctgcacggggcgcctgacgacggc
gtggcgtctggagtgccgccgggcacgccggacgcctactacggaacggacctgccggcg
ctgcgcgcgctgcccggcgcggaccgcatgctggcgcctgccaccgggctgtcggaagcc
cacgtgcgctatgccgtgcggtacgagatggcgcgcaccgtggaagacgtacttgcccgg
cggaaccgggcgctgttcctggacgtcgaggcggctttgctcgcggcgccggaggtggct
cgcgtaatgggtgaagagctgtcgttggatgccgcgtggcagcagcgggaagtggctgcg
ttcggggagttggcggcgcaatatcggttggagtga

DBGET integrated database retrieval system