KEGG   Borreliella garinii NMJW1: BgCN_0197Help
Entry
BgCN_0197         CDS       T02299                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bgn  Borreliella garinii NMJW1
Pathway
bgn00473  D-Alanine metabolism
bgn00550  Peptidoglycan biosynthesis
bgn01100  Metabolic pathways
bgn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BgCN_0197
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BgCN_0197
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BgCN_0197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgn01011]
    BgCN_0197
Enzymes [BR:bgn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BgCN_0197
Peptidoglycan biosynthesis and degradation proteins [BR:bgn01011]
 Precursor biosynthesis
  Amino acid ligase
   BgCN_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 13812408
NCBI-ProteinID: AFT83532
LinkDB All DBs
Position
complement(199799..200869)
Genome map
AA seq 356 aa AA seqDB search
MLIFGGVSFEHEISCKSAYSIYLALLDLNKYNIYPVYIDKCTGIWYLLDSVSDPPKLIDI
DVLPIVSLLPGIGIFSNNKNLEIDVVFPVVHGRTGEDGAIQGVLKVMDIPCIGAGIIGSA
ISSNKYFCKLLLKSFNIPLVPFIGFRQYDYLLDKEEIKRNVREALGYPVIVKPAVLGSSI
GINVAYSENQIEFFIEEALKYDLTILIEKFIEAREIECSIIGNEKIKIFSPGEVVVQDFI
FYDYDAKYSVIPGNSIIFNIPAQLETNQLLSIKEYAFLVYKNLELRGMARVDFFVEKKSG
KIYLNEINTIPGFTDISMFAKMCSHDGLQFKDLVDNLINYAFQSYINRKKRINFED
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttaatatttggtggagtttcttttgaacatgaaatttcttgcaaatctgcttatagc
atttatttagcccttttagatctaaataaatacaatatttatcctgtttatattgataag
tgtacaggtatttggtatttattagattctgtttctgatcctccaaagctcatcgatata
gatgttttacctattgtaagcttattgcctggtattggaattttttcaaataacaaaaat
cttgagattgatgttgttttccctgttgttcatggaagaaccggtgaggatggtgctatt
caaggggttttaaaagttatggacattccttgcattggtgctggcattatagggagcgct
atttctagcaataagtatttttgcaaacttttgcttaaaagttttaatatccctttagtg
ccttttattggatttagacaatatgattatcttttagataaagaggagataaaaagaaat
gtaagggaggctttaggctatcctgttattgttaagcccgcagtattggggtcttcaatt
ggaataaatgtagcttacagtgaaaatcagattgaattttttattgaggaagctttaaag
tatgaccttactattttaatagagaaatttattgaagctagagagattgaatgttctatt
attgggaatgaaaagataaaaatattttctcctggggaagttgttgttcaagattttata
ttttatgactatgatgctaaatattctgttattcctggaaattctattatttttaatatt
cctgcacagcttgagacaaatcagttgttaagcattaaggaatatgcctttcttgtttat
aagaatttagaactcaggggtatggcaagagttgatttttttgttgaaaaaaaatcagga
aaaatttatcttaatgaaataaatactattccgggatttaccgatatatctatgtttgct
aaaatgtgtagtcatgatggtcttcagtttaaagacttggtggataatttaattaattat
gcttttcaaagttacattaatagaaaaaaaagaattaattttgaagattaa

DBGET integrated database retrieval system