KEGG   Borrelia garinii NMJW1: BgCN_0244Help
Entry
BgCN_0244         CDS       T02299                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bgn  Borrelia garinii NMJW1
Pathway
bgn00564  Glycerophospholipid metabolism
bgn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BgCN_0244
Enzymes [BR:bgn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BgCN_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox_3 GIDA Thi4 Pyr_redox 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 13812453
NCBI-ProteinID: AFT83573
LinkDB All DBs
Position
247568..249157
Genome map
AA seq 529 aa AA seqDB search
MEEYLNFMNNNKETKLKNLENQEFDLIIIGGGATGLGIAVDAITRGYKVILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECAFITPIYNILKIPYY
YLGLTYYHNLMGKEKATKYKTKLLSKKSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELVQFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEI
RRLDDEKALNIIKPSQGSHLIIKKDKFPQNHAILIPKTSDNRILFAIPWYDGVVCGSTDI
PIKEVEVEPKRLDEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKAEGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLLPNYPPTTEDLKLHGYLKKEA
AVKIPEPFRTYGSDFEILKNMEGFDKKIHESLDLNEAQIAFSIEFEQAKTIDDVLARRTR
SLPLNPQAAIEAAPRVAEIMMKKLNKSEKWKNEQIKTFLEISKKYLIKN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatttaaatttcatgaataataacaaagaaacaaaattaaaaaatcttgaa
aatcaagaatttgatctcataataattggaggaggcgcaacaggtcttggtatcgcagta
gacgcaatcacaaggggatataaagtaatacttatagaaaaatttgactacgcaaaagga
acttcctctagatcaagcaaattaattcacggtggagtaagatatttagctcaatggaat
atttctttggttaaagaagctttacatgaaaaagcaattcttgaaaaaaatgcacctcat
ttaattaacgaatgtgcatttattacccctatttataatatcttaaaaataccttattat
tatttgggattaacttattaccacaatcttatgggtaaagaaaaagctaccaaatataaa
actaaattactatccaaaaaatctaccattgaaaaagctcctaatattaaaacagaaggc
cttaaatgctctgttttatattacgatgattcattcgatgatgctagaatggcaataaca
ttattaagaacttttaccgaaaaaggaggaattgcccttaactacacagagcttgtacaa
tttaacaaggaaaacggaaaactttcaggggttttaatacaaaataaattgtccaaagaa
caaatttcattaaaaagtaaatgtataataaacgcaacaggaatattttcagatgaaata
agaagattggatgatgaaaaagctttaaacattatcaaaccttcccaaggtagccattta
ataatcaaaaaagacaaattcccccaaaatcatgcaatattaatacctaaaactagtgat
aataggattttattcgctattccttggtatgatggcgtcgtttgtggaagtaccgacatt
ccaataaaagaggtggaagtagagcccaaaagacttgatgaagagattgactttataata
aataatttaaacaattatttaaatattaaaatagaaaaatcagatgtaaaaagcgtatat
actggaataagacccttaataatggatccaaaagccgaaggcaacacttcaaaaatttca
agaaacgaaaaaatatttatatcagattcaaatcttattacaatagcgggaggcaaatat
actacatatagaaaaatggcagaaaaaaccttgctcaaagccatagaaaaaaatttatta
ccaaattatccaccaactacagaagatttaaagttacacggctatcttaaaaaagaagca
gcagtaaaaattcctgaaccttttagaacttatggtagtgactttgaaattctaaaaaat
atggaagggtttgacaaaaagatacacgagagcttggatttaaatgaagctcaaatagcc
ttttcgattgaatttgagcaagccaaaactattgacgatgttttagcaagaagaacaaga
tcgttgcctttaaatccccaagctgcaattgaagctgccccaagggttgctgaaataatg
atgaaaaaattaaataaatctgaaaagtggaaaaatgaacaaataaaaacctttttagaa
ataagcaaaaaatatttaattaaaaattaa

DBGET integrated database retrieval system