KEGG   Borreliella garinii NMJW1: BgCN_0293Help
Entry
BgCN_0293         CDS       T02299                                 

Definition
(GenBank) flagellum-specific ATP synthase
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
bgn  Borreliella garinii NMJW1
Pathway
bgn02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bgn00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BgCN_0293
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgn02044]
    BgCN_0293
   02035 Bacterial motility proteins [BR:bgn02035]
    BgCN_0293
Enzymes [BR:bgn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BgCN_0293
Secretion system [BR:bgn02044]
 Type III secretion system
  Flagellar export apparatus
   BgCN_0293
Bacterial motility proteins [BR:bgn02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BgCN_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N ABC_tran RsgA_GTPase ATPase_2
Motif
Other DBs
NCBI-GeneID: 13812499
NCBI-ProteinID: AFT83618
LinkDB All DBs
Position
complement(296508..297818)
Genome map
AA seq 436 aa AA seqDB search
MSNFFENYLRQVDDIETVSFVGRVQKIKGLLVESLGPQCAVGDLCLIDQRNNKKVCAEVL
GFNGPYVSLMTYEGFSGIEVGNKVYSLNKGLEINLSDELLGRVIDSLGRPIDNKGSFLKN
RYKELTFEKINPINRSIFEEQILTGVKALDGFLPVAKGQRVGIFSGAGVGKSTLLGMIAK
NSNADVNVIAFIGERGRELNEFIEHELGEERLKKSVLVVSTSDESPISRYKGAYVATMIA
EYFRDQGKDVALLFDSITRFANAKREMSLSLGEPPVSKGYPPSVFVEIPILLERSGFNGN
GGSVTGFYTVLVEGDDFTEPVADNIKAVLDGHIILDRDLFDRGIYPSINILSSTSRSINR
IMSLEKQKLIMKARNLLSIYKDYEDLIRTGIYIKGSNKDVDFAISKYPKIIDFISQGINE
IFDFENLEDEIRAILS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatttttttgaaaattatttaagacaagtagatgatattgaaaccgtctctttt
gttggcagggtgcaaaaaataaagggtcttttagttgaaagtttggggcctcagtgtgct
gttggggatttatgtttaattgatcaaaggaataataaaaaggtatgtgctgaggttttg
ggctttaatgggccttatgttagtcttatgacttatgagggatttagcggaattgaagtt
gggaataaagtctattctttaaataaagggctagaaataaatcttagtgatgagctttta
ggaagggttattgattctcttggtaggcccattgataataaagggtcatttttaaaaaat
agatataaagagttaacttttgagaaaattaatccaattaatagaagtattttcgaagaa
caaatattaacaggagttaaagctcttgatgggtttttgccagtcgcaaaagggcaaaga
gttggtattttttctggtgctggcgttggtaaatctactttgcttggcatgattgcaaag
aattcaaatgcagatgtaaacgttatagcttttattggggaaagaggtcgagagcttaat
gagtttattgaacacgagcttggtgaggagcgtttaaaaaaaagtgttttagttgtttca
acttctgatgaatcacctatatcaaggtataaaggagcttatgttgctaccatgatagcg
gaatactttagagatcaaggtaaagatgtagctttgctttttgattctattactaggttt
gctaatgctaaaagggagatgtctctttctttaggagagcctccggtatctaaaggctat
ccgccttctgtttttgttgaaattccaattttacttgagagatcagggtttaatggtaat
ggaggaagtgttactgggttttatactgttcttgttgagggagatgattttacagagcct
gtagccgataatattaaggctgttttagatggtcatattattttagacagagatctattt
gacagaggaatttatccttcaataaatattcttagttcaacttcaagatctattaatagg
ataatgagtttagaaaaacaaaaattaataatgaaagctagaaatttattgtctatttat
aaagattatgaagatcttattagaactggtatttatatcaaaggatccaataaggatgtt
gattttgcaatttccaagtatcccaagattattgattttatttctcaaggaataaatgag
atatttgattttgaaaatttagaagatgaaataagggcaatattatcttga

DBGET integrated database retrieval system