KEGG   Burkholderia gladioli ATCC 10248: BM43_1505Help
Entry
BM43_1505         CDS       T03826                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00010  Glycolysis / Gluconeogenesis
bgo00620  Pyruvate metabolism
bgo01100  Metabolic pathways
bgo01110  Biosynthesis of secondary metabolites
bgo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM43_1505 (acoD)
   00620 Pyruvate metabolism
    BM43_1505 (acoD)
Enzymes [BR:bgo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BM43_1505 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJX00064
UniProt: A0A095W556
LinkDB All DBs
Position
1:complement(1632161..1633681)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQHLNIEFPYRKQYGNFIGGEWVPPVDGQYFDNLSPVTGQAFTAIPRSQEADINL
ALDAAHKAKASWGATPVAERAAVLLRIADRMEQNLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMAAWKIAPALA
AGNCVVLKPAEQTPASILVWAELVQDLLPPGVLNIVNGFGLEAGKPLASSKRISKIAFTG
ETTTGRLIMQYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERAVKRVEKIRQGHPLDAQTMIGAQASAEQLEKILSYIDIGR
QEGAECLTGGERNTLTGELASGYYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEEEAL
EIANDTLYGLGAGVWTRDGGRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYDDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgccgagatgcagcacctgaacatcgaattcccgtaccgcaagcaatacggg
aacttcatcggcggcgaatgggtgccccctgtcgacggccagtacttcgacaatctctcg
cccgtcaccggccaggccttcaccgcgatcccgcgctcgcaggaagccgacatcaacctc
gcgctggacgccgcgcacaaggccaaggcgagctggggcgcgaccccggtggccgagcgc
gccgccgtgctgctgcgcatcgccgatcgcatggagcagaacctggcgcgcctggcggtg
gccgagaccatcgacaacggcaagccgttgcgcgagaccaccgcggccgacatcccgctc
gcgatcgaccatttccgctacttcgcgggctgcgtgcgcgcccaggaaggctcgatcgcc
gacatcggcggcgacctggtggcctatcacttccacgagccgctcggcgtggtcggccag
atcatcccctggaacttcccgatcctgatggcggcctggaagatcgcgccggcgctggcg
gccggcaactgcgtggtgctcaagccagccgagcagacgccggcctcgatcctggtgtgg
gccgagctggtccaggacctgctgccgccgggcgtgctcaacatcgtcaacggcttcggg
ctggaagccggcaagccgctggcctccagcaagcggatctcgaagatcgccttcaccggc
gagactaccaccggccgcctgatcatgcagtacgccagcgcgaacctgatcccggtcacg
ctcgagctgggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggccctggaaggcttcgcgatgttcgcgctgaaccagggggaggtg
tgcacctgcccgtcgcgcgcgctggtcgaggaaagcatctacgaccgcttcatcgagcgc
gccgtgaagcgcgtcgagaagatccgccagggccacccgctcgacgcgcagaccatgatc
ggcgcgcaggcctcggccgagcagctcgagaagatcctgtcctacatcgacatcggccgc
caggaaggcgccgagtgcctgacgggcggtgagcgcaacacgctgacgggcgagctcgcc
agcggctactacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtgctgtcggtgaccaccttcaagaacgaggaggaggcgctt
gaaatcgccaacgacacgctctacgggctcggcgccggcgtgtggacccgcgacggcggc
cgcgcctatcgcttcggccgcgcgatccaggccggccgcgtgtggaccaactgctatcac
gcctatccggcgcatgccgcgttcggcggctacaagcagtcggggatcggccgcgagacg
cacaagatgatgctcgaccattaccagcagaccaagaaccttctggtcagctacgacgac
aagccgctcggcttcttctga

DBGET integrated database retrieval system