KEGG   Burkholderia gladioli ATCC 10248: BM43_1793
Entry
BM43_1793         CDS       T03826                                 

Definition
(GenBank) type IV/VI secretion system, DotU family domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BM43_1793
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgo02044]
    BM43_1793
Secretion system [BR:bgo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BM43_1793
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AJX00069
UniProt: A0A095W8B3
LinkDB
Position
1:complement(1928881..1929666)
AA seq 261 aa
MSYAPSLFGGTTPPPAPHSASSTDASFQARSLLDLLYDGFFMMFLLKNGREPGEANEFRT
RIQEFLADFERGAKKLNAGADDVYAAKFAFCAAIDEAVLSSQFKVRAEWERRPLQLVLFG
EQLAGEKFFQYLEECRAHGVARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEI
AQMKGKRAPFAPHWALPDQIAHRLKREVPLWAIGAVFALVGLLAFVGLNAYLRDHTLKAL
APYSQIIKVGPESANLTISLP
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagctacgcgccctccctgttcggcggcaccacgccgccccccgccccgcattcggcc
tcgtcgaccgacgccagcttccaggcgcgctcgctgctcgacctgctctatgacggcttc
ttcatgatgttcctgctgaagaacggtcgcgagcccggcgaagcgaacgagttccgcacg
cgaatccaggaattcctggccgatttcgagcgcggcgcgaagaagctcaatgccggcgcc
gacgacgtctacgccgccaagttcgcgttctgcgcggcgatcgacgaggcggtgctgtcc
tcgcagttcaaggtgcgtgccgagtgggagcgccgcccgctgcagctggtgctgttcggc
gagcaactggccggcgagaagttcttccagtacctggaggaatgccgcgcgcacggcgtg
gcgcgcctgcagtcgctggaggtgttccacatgtgcctgctgctgggcttccagggcaag
tacctgctcgagggaccggagaagctcgcctacctgaccgcgcggatcggcgacgagatc
gcccagatgaagggcaagcgcgcgcctttcgcgccgcattgggcgctgcccgaccagatc
gcgcaccgcctcaagcgcgaggtgccgctgtgggcgatcggcgccgtgttcgcgctggtc
ggcctgctggccttcgtggggctcaacgcctatctgcgcgatcacacgctgaaggcgctg
gcgccctattcgcagatcatcaaggtcgggccggaatcggccaacctgacgatctcgctg
ccctga

DBGET integrated database retrieval system