KEGG   Burkholderia gladioli ATCC 10248: BM43_1892Help
Entry
BM43_1892         CDS       T03826                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00473  D-Alanine metabolism
bgo00550  Peptidoglycan biosynthesis
bgo01100  Metabolic pathways
bgo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BM43_1892
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BM43_1892
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BM43_1892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgo01011]
    BM43_1892
Enzymes [BR:bgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BM43_1892
Peptidoglycan biosynthesis and degradation proteins [BR:bgo01011]
 Precursor biosynthesis
  Amino acid ligase
   BM43_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST TTL BMC ATP-grasp_4 ATP-grasp_3 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AJW97659
UniProt: A0A095FGX0
LinkDB All DBs
Position
1:2043896..2044837
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLLGGVSAEREVSLKSGTLVVQGLREAGIDAHPFDPSERPLAALKDE
GYVRAFNALHGGYGENGQIQGALDFYGIRYTGTGVLGSALGLDKFRTKLVWQQTGIPTPP
FEVVLRGDDHAARAPEIVAKLGLPLFVKPASEGSSVAVIKVKDAAALPAALDEAARHDKI
VLVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYIADDTQYLIPCGIEAGREA
EVKRLARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLAMTLED
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtactgttgggcggcgtgtcc
gccgagcgcgaggtatcgctgaaatcgggcacgctggtcgtgcaggggctgcgcgaggcc
ggcatcgacgcgcatccgttcgatccgtccgagcggccgttggccgcgctcaaggacgaa
ggctacgtgcgcgccttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgccctcgacttctacggcatccgctacaccggcaccggcgtgctcggctcggcgctc
ggcctcgacaagttccgcaccaagctggtctggcagcagaccggcatccccacgccgccg
ttcgaggtggtgctgcgcggcgacgaccacgccgcgcgcgcgccggaaatcgtcgcgaag
ctgggtctgccgctgttcgtgaagccggccagcgagggctcgagcgtggcggtgatcaag
gtcaaggacgcggcggcgctgcctgccgcgctcgacgaggccgcgcggcacgacaagatc
gtgctggtcgagaagagcatcgagggcggcggcgagtacacggcctgcatcgccggcgac
ctggacctgccggtgatccgcatcgtgccggccggcgagttctacgactaccacgcgaag
tacatcgccgacgacacgcagtacctgattccttgcggcatcgaggccggccgcgaagcc
gaagtcaagcgcctggcgcgccgcgccttcgacgtgctgggctgcaccgactggggccgc
gccgacttcatgctcgacgccgcgggcaacccgtatttcctggaagtcaacaccgcgccg
ggcatgaccgaccactcgctgccgcccaaggctgcgcgcgcggtcggcatcagctactcg
gagctggtggtgaaggtgttggccatgacgctcgaagactga

DBGET integrated database retrieval system