KEGG   Burkholderia gladioli ATCC 10248: BM43_3097Help
Entry
BM43_3097         CDS       T03826                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00020  Citrate cycle (TCA cycle)
bgo00310  Lysine degradation
bgo00380  Tryptophan metabolism
bgo01100  Metabolic pathways
bgo01110  Biosynthesis of secondary metabolites
bgo01120  Microbial metabolism in diverse environments
bgo01130  Biosynthesis of antibiotics
bgo01200  Carbon metabolism
Module
bgo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BM43_3097 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BM43_3097 (sucB)
   00380 Tryptophan metabolism
    BM43_3097 (sucB)
Enzymes [BR:bgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BM43_3097 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AJW98891
UniProt: A0A095HAS2
LinkDB All DBs
Position
1:3401103..3402383
Genome map
AA seq 426 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLSQV
LQNDGDTVVADQVIATIDTEAKAGAVAAAAGEAEVRPAPAPVAVEAAPAAQAAAASGSSN
TTASPAAAKLLAEKGVDPSQVSGTGRDGRITKGDALGANATPVKAASAPAAAPKKAAALP
DVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAK
YKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGL
VVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIIN
PPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPA
RLLLDL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttccgaatcggtttcggaagccaccatg
ctgcagtggaagaagaagcccggcgaggcggtcgcgcaggatgaaatcctgatcgaactc
gagaccgacaaggtcgtgctggaagtgccggcaccggcagccggcgtgctgtcgcaagtg
ctgcagaacgacggcgacacggtcgtcgccgaccaggtgatcgccaccatcgacaccgag
gcgaaggccggtgccgtggccgccgccgccggcgaagccgaagtgcgtccggccccggcg
ccggtcgcggtggaagccgcgccggccgcgcaagcggctgccgcctcgggctcgagcaac
accacggcttcgccggccgcagccaagctgctggccgagaagggcgtcgatccgagccag
gtctcgggcaccggccgcgacggccgcatcaccaagggcgacgcgctgggcgccaacgcc
acgccggtgaaggctgcctcggcgccggccgccgcgccgaagaaggccgccgcgctgccg
gacgtcaaggtgccggcctcggccaccacctggctgaacgatcgtccggaacaacgcgtg
ccgatgtcgcgcctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcagaccaac
gcgatcctgacgaccttcaacgaagtcaacatgcagccggtcatggacctgcgcgcgaag
tacaaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtccttcttcgtc
aaggcggcggtccacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggcaac
gacatcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctg
gtggtgccgatcctgcgcaatgccgatcagctgagcctggccgacatcgagaagaagatc
gccgaattcggtcagaaggccaaggacggcaagctgtcgatcgaggaaatgacgggcggt
accttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaac
ccgccgcagtcggcgatcctcggcgtgcacgccaccaaggagcgcccggtggtcgagaac
ggccagatcgtgattcgcccgatcaactacctcgcgctgtcgtatgaccaccggatcatc
gacggccgcgaagcggtgctttcgctggtcgccatgaaggacgcgctggaagatccggcg
cgcctgctgctcgacctgtaa

DBGET integrated database retrieval system