KEGG   Burkholderia gladioli ATCC 10248: BM43_3874Help
Entry
BM43_3874         CDS       T03826                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00473  D-Alanine metabolism
bgo01100  Metabolic pathways
bgo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BM43_3874 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BM43_3874 (alr)
Enzymes [BR:bgo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BM43_3874 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bgo01011]
 Precursor biosynthesis
  Racemase
   BM43_3874 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJW97995
UniProt: A0A095F416
LinkDB All DBs
Position
1:complement(4331986..4333056)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALVNNLAAARRFAPRSKVWAVVKANAYGHGLARAFPGLRSTDGFGLLD
LEEAVKLRELGWAGPILLLEGFFRSTDVDVIDRYSLTTTVHNDDQLRMLETARLSKPINI
QLKMNSGMNRLGYAPDKYRAAWERARTCPGIGQITLMTHFADADGERGVADQMAAFERGA
EGIAGARSLANSAAVMWHPETHGDWVRPGILLYGASPSGRAADIAGAGLQAAMTLGSELI
AVQNIAKGQAVGYGGAFVAPAQMRIGVVACGYADGYPRIAPEGTPIVVDGVRTRIVGRVS
MDMITVDLTPVPGAGIGARVELWGQALPIDDVAASCSTVGYELMCAIASRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgattcacaccgccgcacttgttaacaatctcgcggcc
gcgcgccgcttcgccccccgctcgaaggtctgggcggtggtcaaggccaatgcctacggg
catggcctggcgcgcgcgttcccgggcctgaggagcaccgacggcttcggcctgctcgac
ctcgaggaggcggtgaagctgcgcgaactgggctgggcggggccgatcctgctgctagaa
ggcttcttccgctcgaccgacgtcgacgtgatcgaccgctacagcctgaccaccacggtc
cacaacgacgatcagctgcgcatgctcgagacggcccgcctgtccaagccgatcaacatc
cagctcaagatgaacagcggcatgaaccggctcggctacgcgccggacaagtatcgtgcc
gcctgggagcgcgcccgcacctgcccgggcatcggccagatcaccctgatgacgcatttc
gccgacgccgacggcgaacgcggcgtggccgaccagatggcggccttcgagcgcggcgcc
gagggcatcgccggcgcgcgcagcctggccaattcggccgccgtgatgtggcatcccgaa
acccacggcgactgggtccgccccggcatcctgctgtacggcgcctcgccctcggggcgc
gccgccgatatcgccggcgccggcctgcaggcggccatgacgctcggctccgagctgatc
gcggtgcagaacatcgccaagggccaggcggtcggctacggcggcgccttcgtcgcgccg
gcgcagatgcgcatcggcgtggtggcctgcggttacgccgacggttatccgcgcatcgcc
ccggagggcacgccgatcgtggtcgacggcgtgcgcacgcggatcgtcggccgggtctcg
atggacatgatcacggtcgacctcacgccggtgccgggcgccggcattggcgcgcgcgtc
gagctgtggggccaggcgctgccgatcgacgacgtcgctgcatcgtgctcgacggtcggc
tacgagctgatgtgcgcgatcgcatcgcgcgtgcccgtgcgcgcggaataa

DBGET integrated database retrieval system