KEGG   Burkholderia gladioli ATCC 10248: BM43_4959Help
Entry
BM43_4959         CDS       T03826                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bgo  Burkholderia gladioli ATCC 10248
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BM43_4959
Enzymes [BR:bgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     BM43_4959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 Fer4_7 PrmA
Motif
Other DBs
NCBI-ProteinID: AJW94666
UniProt: A0A095WAE6
LinkDB All DBs
Position
2:1051181..1052245
Genome map
AA seq 354 aa AA seqDB search
MRLRCMCLVIHAPNDLRYEEGEVEAPGAGQVRVQVAMGGICGSDLHYFRHGGFGAIRLQQ
PMVLGHEVAGTVVEVGEGVTAVSVGDRVAVNPSRPCGKCKYCLEGLPNQCLDMRFYGSAM
RMPHIQGAFRGALVCDAVQCVKVADHVPFSLAAMAEPFAVGLHAVSRAGPLIGRRVLVSG
CGPIGALAVAAAKAHGAREVVATDVVDEPLAVAKALGADKVVNVAADPEWTRAYAADKGS
FDVMLECSGNERALRDGLEVLRPRGVVVQLGLGGDVAIPQNVVVAKELTICGSFRFHSEF
ALAVQLINEGRVDLAPAITRVFPAREANEAFALAGDRRRAMKVLIDFEEAVAEA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcgttgcatgtgtctcgtcattcacgcaccgaacgatctgcgctacgaggag
ggcgaggtcgaggcgccgggcgcgggccaggtgcgcgtgcaggttgcgatgggcggcatc
tgcggctcggacctgcattatttccgtcatggcggcttcggcgcgatccggctgcagcag
ccgatggtgctcggccatgaagtggccggcacggtggtcgaggtgggcgagggcgtgacg
gcggtgagcgtcggcgatcgcgtcgccgtcaatccgagccggccttgcggcaagtgcaag
tactgtctcgaaggcctgccgaaccagtgtctcgacatgcgcttctacggcagcgcgatg
cgcatgccgcatatccagggtgcgttccgcggcgcgctggtgtgcgacgccgtgcagtgc
gtgaaggtggccgaccacgtgccgttctcgctggccgcgatggccgagccgttcgcggtc
ggcctgcacgcggtgtcgcgcgcgggcccgctgatcgggcggcgcgtgctggtgtcgggc
tgcgggccgatcggcgcgctggccgtggccgccgccaaggcgcatggcgcgcgcgaggtg
gtggccaccgacgtggtggacgagccgctggcggtggcgaaggcgctcggcgccgacaag
gtcgtcaacgtcgccgccgatccggaatggacccgggcctacgcggccgacaagggcagc
ttcgacgtgatgctcgaatgctcgggcaacgagcgcgcgctgcgcgacgggctcgaggtg
ctgcgtccgcgcggcgtggtggtgcagctcggcctcggcggcgacgtggcgattccgcag
aacgtggtggtggccaaggaactgacgatctgcggctcgttccgtttccactcggaattc
gcgttggcggtgcagttgatcaacgaaggccgggtcgatctcgcgccggccatcacgcgc
gtgttcccggcgcgcgaggccaacgaggctttcgcgctggccggcgatcgtcggcgcgcg
atgaaggtgctgatcgacttcgaggaagccgtcgccgaagcctga

DBGET integrated database retrieval system