KEGG   Burkholderia gladioli ATCC 10248: BM43_5003Help
Entry
BM43_5003         CDS       T03826                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00440  Phosphonate and phosphinate metabolism
bgo01100  Metabolic pathways
bgo01120  Microbial metabolism in diverse environments
bgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BM43_5003 (aepX)
Enzymes [BR:bgo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BM43_5003 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL PEP_hydrolase IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AJW94687
UniProt: A0A095WAH4
LinkDB All DBs
Position
2:complement(1097638..1099323)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRAARLRRMLTSSDLEFLMEAHNGLSARIVREAGFKGIWGSGLSISAALG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFAGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
AHAYADAGADAILMHSKLSRPDEILEFARQWNNRAPIVIVPTKYYSTPTDVFRQAGISTV
IWANHLVRSAAASMQATARDIFENQTLVNVEDRVATVNEIFRLQDADEYSAAERIYLSSS
SRSSNSAIVLAASRGKGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKEGVNDITVVGGYR
ADAIDTAGIKLVVNERHAETGELSSLACALERIKGDTIVSYGDLLFRSYIVRDLAESDAE
FTVVVDSSLTDSPNQSVRDFALCSAPDDRGLFGQKITLQRVAGDAGNGAPHGRWVGLLNV
RGAGVERLKATIAKLQARPDFDQLDIPALLNALVEAGEQISVQYVHGHWRGVNDLDEFRR
AGDFAHGQTPLANGAAAGDAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaatttcaccgaatcccgcgcggcgcggctgcgccgcatgctg
accagcagcgacctcgaattcctgatggaagcgcacaacggcctgtcggcgcgcatcgtg
cgcgaggccggcttcaagggcatctggggctcgggcctgtcgatctcggccgcgctcggc
gtgcgcgacaacaacgaggcgagctggacccaggtggtcgacgtgctcgagttcatggcc
gatgccagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
atgcgccgcctggtgcgcaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcaattccccaagaccaacagcttcatcgacggcgagcgccagccgctggccgagatc
gacgagttcgcgggcaagatcaaggccggcaaggattcgcagaccgatccggacttctcg
atcgtggcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgcatgcctacgccgatgccggcgccgacgcgatcctgatgcacagcaagctgtcgcgt
ccggacgagatcctcgaattcgcgcgccagtggaacaaccgcgcgccgatcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctggtccgctcggcggcggcctcgatgcaggccaccgcgcgcgac
atcttcgagaaccagaccctggtcaacgtcgaggaccgcgtcgccaccgtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggcggccgagcgcatctacctgtcctcctcc
tcgcgttcgtcgaactcggcgatcgtgctggccgccagccgcggcaagggcctggaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgctgcgctgg
ctggtggacggcttcaagaaggaaggcgtcaacgacatcacggtggtgggcggctatcgc
gccgacgcgatcgacaccgccggcatcaagctggtggtcaacgagcgccacgccgaaacc
ggcgaactgagctcgctggcctgcgcgctcgagcgcatcaagggcgacaccatcgtctcc
tacggcgacctgctgttccgcagctacatcgtgcgcgacctggccgagagcgatgccgaa
ttcacggtggtggtcgattcatcgctgaccgattcgccgaaccagagcgtgcgcgacttc
gccctgtgctcggcgcccgacgaccgtggcctgttcggccagaagatcacgctgcagcgc
gtggcgggcgacgccggcaacggcgcgccgcacggccgctgggtcggcctgctgaacgtg
cgcggcgccggcgtggagcgcctcaaggcgaccatcgcgaagctgcaggcacgcccggac
ttcgaccagctcgacatcccggccctgctcaacgcgctggtggaagccggcgagcagatc
tcggtgcaatacgtgcacggccactggcgcggcgtgaacgacctcgacgaattccgtcgc
gccggcgacttcgcccacggccagacgccgctggccaacggcgccgccgccggggacgcg
caatga

DBGET integrated database retrieval system