KEGG   Burkholderia gladioli ATCC 10248: BM43_5834Help
Entry
BM43_5834         CDS       T03826                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BM43_5834
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgo02000]
    BM43_5834
Enzymes [BR:bgo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BM43_5834
Transporters [BR:bgo02000]
 Other Transporters
  Pores ion channels [TC:1]
   BM43_5834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJW96773
UniProt: A0A095HP81
LinkDB All DBs
Position
2:2162106..2162777
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYELKRYERDPKTMLAPPELRAIHPLGKSPVLTDEG
FTMAESGAIIEYLVERYGEGRFAPPPGTPQRLRYTYWLHYAEGSAMPPLLLKLVALRIAQ
APMPFFARPIARKISSTLQSSFVDPQLKLHLGYVDAALRETGWFVGDSFSAADVQMSFPL
EAAASRADTLAQLPAIRAFLERIHARPAYQRALERGGPYAMVG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccaccacctgaacaactcgcgctcgcagcgcgtgctctggctgctagaa
gaactcggcgttccctacgaactcaagcgctacgagcgcgatcccaagaccatgctcgcg
ccgcccgagctgcgcgccatccatccgctcggcaagtcgccggtgctcaccgacgaaggc
ttcacgatggccgagtcgggcgcgatcatcgagtatctggtcgagcgctacggcgagggc
cgtttcgccccgccgccgggcacgccgcagcggctgcgctatacctactggctgcactac
gcggaaggctcggcgatgccgccgctgctgctcaagctggtggcgctgcgcatcgcgcag
gcgccgatgccgttcttcgccaggccgatcgcgcgcaagatctcgtcgacgctgcaatcg
agcttcgtcgatccgcagttgaagctccatctcggctacgtcgacgcggcgctgcgcgag
accggctggttcgtcggcgacagcttcagcgccgccgacgtgcagatgagctttccgctg
gaagcggccgcctcgcgcgccgacacgctcgcgcaactgccggcgatccgcgccttcctg
gagcgcatccatgcgcggcccgcctaccagcgcgcgctggaacgcggcggcccctacgcg
atggtcggctga

DBGET integrated database retrieval system