KEGG   Burkholderia gladioli ATCC 10248: BM43_5907Help
Entry
BM43_5907         CDS       T03826                                 

Definition
(GenBank) ring hydroxylating alpha subunit family protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00627  Aminobenzoate degradation
bgo01100  Metabolic pathways
bgo01120  Microbial metabolism in diverse environments
Module
bgo_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BM43_5907
Enzymes [BR:bgo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BM43_5907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AJW95794
UniProt: A0A095FDG9
LinkDB All DBs
Position
2:complement(2255080..2256351)
Genome map
AA seq 423 aa AA seqDB search
MELTETPVRLADRHDTAELRFPREDGSRVPYKVFSSQAVYEREQERIFRGPTWNFVALEA
ELPKPGDFKSSFVGDTPVVVTRGEDGTLSAWVNRCAHRGAQVCRQARGNASSHTCVYHQW
SFDNAGNLLGVPFRRGQKGMTGMPPDFDPKQHGLRQLRVESYRGLVFASFSEEVAPLPEY
LGAEMRPWIDRIFHKPIEYLGCTRQYSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITVTKTGEDTSAAYKQQNIRSFDEGFALEDDSILGLVSEYDEDT
TNHIQPIFPQLVIQQIHNTLVARQLLPKGPGNFELVFHFFGYADDTPELRALRIKQANLV
GPAGYISMEDTEATELVQRGTFRDPDASSVIEMSRSNPDQQDTVITESLIRRFWVGYQKL
MGY
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaccgaaacgccggtgcggctcgccgaccgtcacgacacggccgaactgcgt
tttccgcgcgaggacggctcgcgcgtaccctacaaggtgttcagctcgcaggccgtctac
gagcgcgagcaggagcggatctttcggggtcctacctggaacttcgtggcgctcgaggcc
gagctgcccaagccgggcgatttcaagagcagtttcgtcggcgacacgccggtggtggtc
acgcgcggcgaggacggcacgctctcggcctgggtcaaccgctgcgcgcatcgcggcgcg
caggtgtgccgccaggcacgcggcaacgccagctcgcatacctgcgtctaccaccaatgg
agcttcgacaatgccggcaacctgctcggcgtgccgttccggcgcgggcagaagggcatg
accggcatgccgcccgatttcgatccgaagcagcacgggttgcgccagctgcgcgtcgag
agctatcgcggcctggtgttcgcgagcttcagcgaggaagtcgcgccgctgcccgagtac
ctgggcgcggaaatgcggccctggatcgaccgcatcttccacaagccgatcgagtacctc
ggctgcacgcggcaatactcgaagtcgaactggaaactctacttcgagaacgtgaaggac
ccgtatcacgcgagcatgttgcacctgttccataccaccttcaatatcttccgggtcggc
atgaaggcgcgctcgatccccgacgcgacgcacggcctgcacagcatcatcaccgtcacc
aagaccggcgaggacacctcggcggcctacaagcagcagaacatccgctccttcgacgag
ggcttcgcgctggaggacgattcgatcctggggctggtgtccgaatacgacgaggacacc
accaaccacatccagccgatcttcccgcaactggtgatccagcagatccacaacacgctg
gtggcgcgccagttgctgcccaaggggccgggcaacttcgagctggtgttccacttcttc
ggttatgccgacgacacgcccgagctgcgcgcgctgcgcatcaagcaggccaacctggtg
gggccggccggctacatctcgatggaggacaccgaggccaccgagctggtgcagcgcggc
accttccgcgatcccgacgcgagctcggtgatcgagatgtcgcgcagcaatcccgaccag
caggacacggtgatcaccgaaagcctgatccggcgtttctgggtcggctaccagaagctg
atgggctattga

DBGET integrated database retrieval system