KEGG   Burkholderia gladioli ATCC 10248: BM43_620Help
Entry
BM43_620          CDS       T03826                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00620  Pyruvate metabolism
bgo00680  Methane metabolism
bgo00710  Carbon fixation in photosynthetic organisms
bgo01100  Metabolic pathways
bgo01120  Microbial metabolism in diverse environments
bgo01200  Carbon metabolism
Module
bgo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BM43_620
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BM43_620
   00680 Methane metabolism
    BM43_620
Enzymes [BR:bgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BM43_620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 YbjN
Motif
Other DBs
NCBI-ProteinID: AJW97989
UniProt: A0A095FFR8
LinkDB All DBs
Position
1:661371..664472
Genome map
AA seq 1033 aa AA seqDB search
MKSSGSARAARRNTASSNVTAPAPAEAPAQARGKQAASPAGPATTKPARKTASKAAAKPE
TKQASAATTKPAAPATSTRPTTSPKRAAAPKTNGRTREDKDQPLFEDIRYLGRLLGDVVR
EQEGEAVFQVVETIRQHAVKFRREDDREAAQTLDRMLRKLTPEQTVSVVRAFSYFSHLAN
IAEDRHHNRRRRIHALAGSTPQAGTVGFALQALKDAGDASAEVIRRFFDEALIVPVLTAH
PTEVQRKSILDAQHDIARLLAERDQQLTTRERSHNESLLRARVTSLWQTRMLRDARLTVG
DEIDNALSYYRATFLDELPALYADIEEALAEHGLDARVPAFFQMGSWIGGDRDGNPNVTA
ATLEEAIHRQGTVILEHYLEQVHKLGAELSVSHLLVGASDEVKALAAASPDQSPHRVDEP
YRRALIGIYTRIAASARVRLGEGVVAVRSAGRGAPPVRATPYADSEAFARDLRVLQDSLV
AHHGASLTTPRLAPLVRAAEVFGFHLASIDLRQSSDIHEAVIAELFARAGVEADYAALAE
ADKLRVLLAALADPRPLRIPYLDYSDLAKSELGVLEKAREVRAKFGPRAVRNYIISHTET
VSDLVEVLLLQKETGLLEGSFGAYGHARHGLMVIPLFETIADLQNAPEIMRDYFALPGMQ
ALVAHQGGEQEVMLGYSDSNKDGGFLTSNWELYRAELSLVELFSAHGIKLRLFHGRGGTV
GRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASKFSNPEIGRRNLETVVAATLEASLLP
RNNAPAQLPAFEATMQTLSDAAMGAYRALVYETPGFKDYFFSSTPISEIAELNIGSRPAS
RKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAFAAYLDGAANSANPAAERAKR
LALLQKMNRNWPFFSHLLSNMDMVLAKTDLAVASRYAELVADKKLRKHVFARIVAEWERT
AAALAEITGHEARLAANPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARVRRGIHL
TINGIAAGLRNTG
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctccggatcggcgcgcgccgcgcgccgcaatactgcctcgtccaacgtcacc
gcgccggcacccgccgaagcgcccgcgcaagcgcgcggcaagcaggccgccagcccggcc
ggcccagccacgacgaaaccggcccgcaagaccgccagcaaggcggccgccaagccggaa
accaagcaggcaagcgccgcgaccacgaaacccgccgccccggccacctcgacacgcccg
accacctcgcccaagcgcgccgccgcgccgaaaacgaacggccgtacgcgcgaggacaag
gaccagccgctgttcgaggacatccgctacctgggacgcctgctcggcgacgtggtgcgc
gagcaggaaggcgaggcggtattccaggtggtcgagacgatccgccagcacgccgtgaaa
ttccgccgcgaggacgaccgcgaggccgcgcagacgctcgaccgcatgctgcgcaagctc
acgcccgagcagaccgtcagcgtggtgcgcgctttcagctacttctcgcacctggccaat
atcgccgaggaccgccatcacaaccgccgccgccgcatccacgcgctggccggctcgacg
ccgcaggccggcacggtcggcttcgcgctgcaggcgctgaaggacgccggcgacgcctcg
gccgaggtgatccgccgcttcttcgacgaggccctgatcgtgccggtgctgaccgcccac
ccgaccgaggtgcagcgcaagagcatcctcgacgcccagcacgacatcgcccgcctgctc
gccgagcgcgaccagcaactgaccacgcgcgagcgctcgcacaacgaatcgctgctgcgc
gcgcgcgtgacctcgctgtggcagacccgcatgctgcgcgacgcgcgcctgacggtcggc
gacgagatcgacaacgcgctgtcctattaccgcgccaccttcctcgacgagctgccggcg
ctctacgccgacatcgaggaggcgctggccgagcacggcctggacgcgcgcgtgccggcc
ttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccgaacgtgaccgcc
gccaccctggaggaggcgatccatcggcaaggcacggtgatcctcgagcactacctggag
caggtccacaagctcggcgccgagctgtcggtctcgcacctgctggtgggcgccagcgac
gaagtgaaggcgctggccgcggcctcgccggaccagtcgccgcatcgcgtcgacgagccc
taccggcgcgcgctgatcggcatctacacgcgcatcgccgccagcgcccgggtgcgcctg
ggcgagggcgtggtggcggtgcgcagcgccggccgcggcgcgccgccggtgcgcgccacg
ccctatgccgattccgaggccttcgcgcgcgatttgcgcgtgctgcaggattcgctggtc
gcgcatcacggcgcctcgctgaccacgccgcgcctggcgccgctggtgcgcgccgccgag
gtgttcggcttccacctggccagcatcgacctgcgccagagctcggacatccacgaggcg
gtgatcgccgagctgttcgcgcgcgccggcgtcgaggccgactacgcggcgctcgccgaa
gccgacaagctgcgcgtgctgctggccgcgctggccgacccgcgcccgctgcgcatcccc
tatctcgactattccgatctcgcgaagagcgaactcggcgtgctcgagaaggcccgcgag
gtgcgtgccaagttcggcccgcgcgcggtgcgcaactacatcatctcgcacaccgaaacg
gtatcggacctggtcgaggtgctgctgctgcagaaggaaaccggcctgctggaaggcagc
ttcggcgcgtacggccatgcccggcacggcctgatggtgatcccgctgttcgagaccatc
gccgacctgcagaacgcgcccgagatcatgcgcgactacttcgcgctgcccggcatgcag
gcgctggtcgcccaccagggcggcgagcaggaagtcatgctcggctactcggacagcaac
aaggacggcggcttcctgacctcgaactgggagctgtatcgcgccgagctgtccctggtc
gagctgttcagcgcccacggcatcaagctgcgcctgttccacggccgcggcggcacggtc
ggccgcggcggcggcccgacctaccaggcgatcctctcgcagccgccgggcaccgtgaac
ggccagatccgcctgaccgagcagggcgaggtgatcgccagcaagttctcgaaccccgag
atcggccggcgcaacctggaaaccgtggtggccgccacgctggaggcctcgctgctgccg
cgcaacaacgcgcccgcgcaactgccggccttcgaggcgaccatgcagacgctgtcggac
gcggcgatgggtgcctatcgcgcgctggtctacgagacgcccggcttcaaggactacttc
ttctcctcgacgccgatcagcgagatcgccgagctcaacatcggcagccgcccggcctcg
cgcaaactgcaggacccgaagaaccgcaagatcgaagacctgcgcgcgattccctggggc
ttctcgtggggccagtgccggctgctgctaaccggctggtacggcttcggcagcgccttc
gcggcctacctcgacggcgcggccaactcggccaaccccgcggccgagcgcgccaagcgc
ctggctttgctgcagaagatgaaccgcaactggccgttcttctcgcacctgctgtcgaac
atggacatggtgctggccaagaccgacctggccgtggcctcgcgctacgccgagctggtg
gccgacaagaagctgcgcaagcacgtgttcgcgcgcatcgtcgccgaatgggagcgcacc
gccgccgcgctggccgagatcaccggtcacgaggcgcggctggcggccaacccgctgctg
gcgcgttcgatcaagaaccgcttcccctacctcgatccgctcaaccacctgcaggtcgag
ctgatcaagcggcaccgcgcgggcgacaccaatgcgcgcgtgcggcgcgggatccatctg
accatcaacggcatcgcggcgggcctgcgcaataccggctga

DBGET integrated database retrieval system