KEGG   Burkholderia gladioli ATCC 10248: BM43_6622Help
Entry
BM43_6622         CDS       T03826                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgo  Burkholderia gladioli ATCC 10248
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BM43_6622 (ahpF)
Enzymes [BR:bgo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BM43_6622 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like Thi4 K_oxygenase DAO NAD_binding_8 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AJW94898
UniProt: A0A095GCR1
LinkDB All DBs
Position
2:3112540..3114138
Genome map
AA seq 532 aa AA seqDB search
MLEANLKNQLKSYLDKLTRPIELVASLDDGAKSQELIALLKEIGELSPRVAVIERRDDAE
RKPSFSIGEPGKAAGIRFAGIPMGHEFTSLVLALLQVGGHPLKLDEDTIEQIRNLDGDFS
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKIDTGASERAAKALANKEVFDVLVVGGGPAGAAAAIYSARKGIRTGV
VAERFGGQVLDTMAIENFISVQETEGPKFAAALEQHVKQYDVDVMDVQRAAALVPGKVNE
IHLENGAVLKAKTIVLSTGARWRELNVPGEREYRNKGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVREVTLIEFGQTLRADEVLQRKLRSLPNVTVVTSAQTKELTGDGQKL
NGLIYLERETGETKRIDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSIPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRQDVEAPATAAAPLREAVEA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagccaatctcaagaaccagttgaagtcgtacctcgacaagctcacccgcccg
atcgaactcgtcgcctcgctcgacgacggcgcgaagtcgcaggagctgatcgcgctgctg
aaggagatcggcgagctgtcgccgcgcgtggccgtgatcgaacgccgcgacgacgccgag
cgcaagccctcgttcagcatcggcgaaccgggcaaggctgccgggatccgctttgccggc
atcccgatgggccatgaattcacctcgctcgtgctggcgctgctgcaggtcggcggccac
ccgctcaagctcgacgaggacaccatcgaacagattcgcaatctcgacggcgatttttcc
ttcgagacgtatttctcgctgtcctgccagaactgcccggaagtggtccaggcgctgaac
gtgatggcgctgatcaacccgcgcatccgccacgtggcgatcgacggcgcgctgttccag
aacgaagtcgaggcacgccagatcatggcggtgccgaccatgttcctgaacggcgagagc
ttcggccagggccgtagcagcgtgaaggaaatcctcgcgaagatcgacacgggcgccagc
gagcgtgccgccaaggcactcgccaacaaggaagtgttcgacgtgctggtggtgggtggt
ggcccggctggcgcggcggccgcgatctactcggcacgcaagggcattcgcaccggcgtg
gtggcggagcgcttcggcgggcaggtgctggacaccatggcgatcgagaacttcatctcc
gtccaggaaaccgaaggaccgaagttcgccgccgcgctggagcagcacgtcaagcaatac
gacgtcgacgtgatggacgtgcagcgcgccgcggcgctggtcccgggcaaggtcaacgag
atccacctggaaaacggcgcggtgctgaaggccaagaccatcgtgctgtcgaccggcgcg
cgctggcgcgagctgaacgtgccgggtgaacgcgagtatcgcaacaagggcgtggcctac
tgcccgcattgcgatggcccgctgttcaagggcaagcgcgtggccgtggtgggcggcggc
aactcgggtgtcgaggccgcgatcgacctggccggcatcgtgcgcgaagtcacgctgatc
gaattcggccagacgctgcgcgccgacgaagtgctgcagcgcaagctgcgcagcctcccg
aacgtgacggtggtgaccagcgcgcaaaccaaggagctgacgggcgacggccagaagctg
aacggcctgatctacctcgaacgtgaaacgggcgaaaccaagcgcatcgacctcgaaggc
gtgttcgtgcagatcggcctggtgccgaacacggaatggctgaagggcacgatcgagctg
tcgaagcacggcgagatcgtggtggatgcgcgcggcgcgacgtcgattcccggcgtgttc
gcggccggcgacgtgaccacggtgccctacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcttcgttgtcggccttcgactacctgatccgccaggacgtcgaggcacccgcg
acggcagcggcaccgttacgcgaagccgtcgaagcgtga

DBGET integrated database retrieval system