KEGG   Burkholderia gladioli ATCC 10248: BM43_6684Help
Entry
BM43_6684         CDS       T03826                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00550  Peptidoglycan biosynthesis
bgo01100  Metabolic pathways
bgo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BM43_6684
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BM43_6684
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bgo01003]
    BM43_6684
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgo01011]
    BM43_6684
Enzymes [BR:bgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BM43_6684
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BM43_6684
Glycosyltransferases [BR:bgo01003]
 Polysaccharide
  Bacterial polysaccharide
   BM43_6684
Peptidoglycan biosynthesis and degradation proteins [BR:bgo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BM43_6684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AJW94856
UniProt: A0A095HKP9
LinkDB All DBs
Position
2:complement(3196246..3198852)
Genome map
AA seq 868 aa AA seqDB search
MSRRFLSSLLSRLAAWRAAARPVLASALARARPPVSRALALLWHHLRHPTRRGVLIVVAA
VPALFLLYVLVLIPFTPSIGDIRKARVDAPAQVMSSDGKLLAEFKPSNREWVALADISPH
MVDALIATEDHRFYEHHGLDWRRTAGAALHTFSGDRQGGSTITQQLARNLYPDQIGRAPT
LTRKLKEAITALKIEAVYSKPQILETYLNTVPFLYNAYGVEMAARTYFDKSADQLDVLDS
ATLVGMLKGNSYYNPVINPERALQRRNTVLGQMVKYGKLTPAQFAVLQKKPLRIDFERQK
EPPGPAPHFAQQLRKWLIGWADRNDYNIYSDGLIVRTTIDSRMQSMATAALKLQANQLQG
IANSAWNSGSGCAFGSPLFQTFIRETPEYKAARDGGADDAAALKALGKQREFLRDLCKAK
ADVQAGFMAIDPRDGAIRAWVGSRDFSTEPFDHVQQARRQPGSTFKAFVYGAAFADGAKP
TDTFIDQPVEIPLKGGEIWRPDDAETPTGKPMTLADALAYSRNRITAQLMQQVGPVKVAR
LAREMGVRDSTLEAVPSLALGTSPVTLKEMVSAYATIANLGSYVEPRMVTRIEDRDGNVL
AEFMPAPPERTLSTSASRTLVEALRGVINRGTGSAIRSRFGIRADVAGKTGTTQGNTDGW
FILMQPQLVAGAWVGFDDGRVTLGDTWGQGARSALPMVGDFYQRVFRAKLIDARVRFDTE
APPGFFDTLRGKLDDWIAYLFPSKPEKPAVPQKPRAPAPAPAPSEAEQAASAASAASAAA
AAEAASDPLGAFLKGGGAAGGHAASGVDTFSASAPPLLPSAPAGGGNHGSGNGGASGGGQ
DNGLPSEPPAESPTPTPDTPSSGNGNGQ
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtcgtttcctgtccagcctgctttcccgcctcgccgcctggcgggccgccgcc
cggcccgtgctggcctcggccctggcccgcgcgcggccgcccgtctcgcgcgcgctggcc
ctgctctggcaccacctgcggcatcccacgcgccgcggcgtgctgatcgtcgtggcggcc
gtcccggcgctgttcctgctctacgtgctggtgctgatcccgttcacgccgagcatcggc
gacatccgcaaggcccgggtcgacgcgccggcccaggtgatgtcctcggacggcaagctg
ctggccgaattcaagccctcgaaccgcgagtgggtggcgctggccgatatctcgccgcac
atggtggacgcgctgatcgccaccgaggaccaccgcttctacgagcatcacgggctcgac
tggcggcgcaccgccggcgccgcgctgcacaccttctcgggcgaccgccagggcggctcg
accatcacccagcagctcgcccgcaatctctatccggaccagatcggccgcgcgcccacg
ctcacgcgcaagctcaaggaggcgatcaccgcgctgaagatcgaggccgtctacagcaag
ccgcagatcctcgagacctacctgaacacggtgcccttcctctacaacgcctatggcgtg
gagatggccgcgcgcacctatttcgacaagtcggccgaccagctcgacgtgctcgacagc
gccaccctggtgggcatgctcaagggcaacagctactacaacccggtgatcaatcccgag
cgtgcgctgcagcggcgcaacacggtgctcgggcagatggtcaagtacggcaagctgacg
ccggcgcagttcgcggtgctgcagaagaagcccctgcgcatcgacttcgagcggcagaag
gagccgcccggcccggcgccgcatttcgcgcagcagttgcgcaaatggctgatcggctgg
gccgaccgcaatgactacaacatctactcggatggcttgatcgtcaggaccacgatcgat
tcgcgcatgcagtcgatggccaccgcggcgctcaagctgcaggccaaccagctgcagggc
atcgccaacagcgcctggaattcgggcagcggctgcgcgttcggcagcccgctgttccag
accttcatccgcgagacgcccgagtacaaggccgcgcgcgacggcggcgccgacgatgcc
gccgcgctgaaggcgctcggcaagcagcgcgagttcctgcgcgatctctgcaaggccaag
gccgacgtgcaggccggcttcatggcgatcgacccgcgcgacggcgcgatccgcgcctgg
gtcggcagccgtgatttcagcaccgagcccttcgaccatgtgcagcaggcacgccggcag
ccgggttcgaccttcaaggccttcgtctacggcgccgccttcgccgacggcgccaagccc
accgataccttcatcgaccagccggtggagatcccgctcaagggcggcgagatctggcgc
cccgacgacgccgagacgcccaccggcaagccgatgacgttggccgacgcgctggcctat
tcgcgcaaccgcatcaccgcgcagctgatgcagcaggtcgggccggtcaaggtggcgcgg
ctcgcgcgcgagatgggcgtgcgcgacagcacgctggaggcggtgccctcgctggcgctg
ggcaccagccccgtcacgctcaaggagatggtctcggcctacgcgaccatcgccaacctc
ggcagctatgtggagccgcgcatggtgacccgcatcgaggatcgcgacggcaacgtgctg
gccgagttcatgccggcgccgccggaacgcacgctgtccacctcggcctcgcgcacgctg
gtggaggcgctgcgcggcgtgatcaatcgcggcaccggctcggcgattcgctcgcgcttc
gggatccgcgccgacgtggccggcaagaccggcaccacccagggcaataccgatggttgg
ttcatcctgatgcagccgcaactggtggcgggcgcctgggtcggcttcgacgacggccgc
gtcacgctcggcgatacctgggggcagggcgcgcgcagcgccttgcctatggtcggcgat
ttctaccagcgcgtgttccgcgccaagctgatcgacgcgcgggtgagattcgataccgag
gcgccgccgggtttcttcgataccttgcgtggcaagctcgacgactggatcgcctatctg
ttcccgtccaagccggagaagccggccgtgccgcagaagccgcgcgcgccggcaccggcc
ccggcgccgagcgaggcggagcaggcggccagtgccgcgagcgctgcctcggcggcggcc
gcggccgaggcggcttcggatccgctcggcgcattcctgaagggcggcggcgcggcgggc
ggccatgccgcgtcgggcgtggataccttcagtgcctcggcgccgccgctgctgccttcg
gcgccggccggcggcggtaatcacggcagtggcaatggtggcgcgagcggtggcgggcag
gacaacggcctgccgagcgagccgccggccgaatcgccgacgcccacgccggatacgccg
tcgtcgggcaacggcaacgggcaataa

DBGET integrated database retrieval system