KEGG   Burkholderia gladioli ATCC 10248: BM43_6973Help
Entry
BM43_6973         CDS       T03826                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00010  Glycolysis / Gluconeogenesis
bgo00052  Galactose metabolism
bgo01100  Metabolic pathways
bgo01110  Biosynthesis of secondary metabolites
bgo01120  Microbial metabolism in diverse environments
bgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM43_6973
   00052 Galactose metabolism
    BM43_6973
Enzymes [BR:bgo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BM43_6973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF5038 DUF2437
Motif
Other DBs
NCBI-ProteinID: AJW96228
UniProt: A0A095FCL0
LinkDB All DBs
Position
2:3542677..3543846
Genome map
AA seq 389 aa AA seqDB search
MRSSPLHPPRLAACALFAAGLLAASLAPAATLSQAPYGTTKDGKPVTEYTLRNARGTTVK
LINYGGVITAIEVPDRHGKSANIVLGFASLKDYEAYNGNIHFGALIGRYANRIAGGQFQL
DGQTYKLPINNAPNTLHGGPDSFDSKVWSAKPLDGGKDGAGVELSYVSPDGENGFPGTLT
VHVTYRLTDDNALHIVYEASTDKDTVVNLTNHTYFNLAGEGSGSVEDQEIRIAASRYTPT
DRTSIPTGELASVEGTPLDLRKPTPIGKHLRSDFEQMVYARGYDHNWVLDAGGPSTPAFA
ASVRDPRSGRVLSVDTTQPGLQFYSANSLDGSAVGASGHAYRQTDAFALEAEHFPDSPNH
PAFPTTELKPGQTLHEETVLRFSVAGRKR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagatcgtctcccctgcatccgccgcgcctggcagcctgcgcgctgttcgcggcaggc
ctgctggccgcctcgctcgcgccggccgccacgctgagccaggcgccttacggcaccacc
aaggacggcaagcccgtcaccgagtacacgctgaggaacgcgcgcggcaccaccgtcaag
ctgatcaactacggtggcgtgatcaccgcgatcgaggtgccggaccggcatggcaagtcc
gccaatatcgtgctcggcttcgcctcgctgaaggattacgaggcctacaacggcaacatc
catttcggcgccctgatcggccgctacgcgaaccgcatcgccggcggccagttccagctc
gacggccagacctacaagctgccgatcaacaacgcgcccaacacgctgcacggcgggccc
gacagtttcgattcgaaggtctggagcgcgaagccgctcgacggcggcaaggatggcgcg
ggcgtcgagctgagctacgtgagccccgacggcgagaacggcttccccggcacgctgacg
gttcacgtcacctaccggctcaccgacgacaacgcgctgcatatcgtctacgaggcgagc
accgacaaggacacggtggtcaacctgaccaaccacacctacttcaacctggccggcgag
ggcagcggcagcgtggaggaccaggagatccgcatcgcggcctcgcgctacacgccgacc
gatcggacctcgatccccaccggcgaactggcctcggtggaaggcacgccgctggacctg
cgcaagcccacgccgatcggcaagcacctgcgttccgatttcgagcagatggtgtatgcg
cgcggctacgaccacaactgggtgctcgacgcgggcgggccgagcacgccggcctttgcc
gccagcgtgcgcgatccgcgcagcggccgcgtgctgagcgtggataccacgcagccggga
ctgcagttctactcggcgaattcgctggacggcagcgcggtgggcgcctcgggccatgct
taccggcagaccgatgcgttcgcgctcgaggccgagcatttccccgattcgccgaatcat
ccggcgtttccgaccacggagctgaagccggggcagacgctgcacgaggaaaccgtgctg
cgtttctcggtggcggggcggaagcgatag

DBGET integrated database retrieval system