KEGG   Burkholderia gladioli ATCC 10248: BM43_7140Help
Entry
BM43_7140         CDS       T03826                                 

Definition
(GenBank) kinase domain protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bgo  Burkholderia gladioli ATCC 10248
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bgo01001]
    BM43_7140
Enzymes [BR:bgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BM43_7140
Protein kinases [BR:bgo01001]
 Serine/threonine kinases: Other
  Bacterial family
   BM43_7140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like
Motif
Other DBs
NCBI-ProteinID: AJW95987
UniProt: A0A095F6L5
LinkDB All DBs
Position
2:complement(3735619..3737055)
Genome map
AA seq 478 aa AA seqDB search
MTRLPEPLPASIGRYRIENVLGRGAMGVVYLATDPHIQRPVALKTIRGELLHAAEAGGEP
GIAAEAALPARFINEARAAGRLVHPNIVGVFDYGEADGTAYIAFEYVRGETLAARLAAHA
RQGTRMPARNVLVWFAQLLDALAYAHELGVIHRDIKPANLLIAPRGECKITDFGIAQLDT
GRLTQVGMLIGTPSYMSPEQVSGAPIDARSDLFSAGVVLYEMLTGRCPFAGSSAAVMRQV
LDETPSPPSSLAPELPPELDAMVLQALAKDPGQRHASAQHWRGEVLALLETLAARLDPDQ
TIVLAPLAQAALAPPPAAEARTLPVDWSPEFLAQLEQRLVTHVGPVASRLVRRAAAQATD
PRMLAAELARHLPDEAARQDFDTLLQRHAASGTAVTRVMTMPGATQAGSGAGQAPAVDTA
LVETAVQRLATHIGPIARIVARRAAVDADLATFQARLLEALPDSVDKAAFLRGLDEGS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcctgccggaaccgctgccggccagcatcggccgctaccgcatcgaaaacgtg
ctgggccgcggcgcgatgggcgtggtctatctcgccaccgatccgcatatccagcggccg
gtggcgctcaagaccatccgcggcgagctgctgcacgcggccgaggcgggcggcgagccc
ggcatcgccgccgaggccgcgctgccggcgcgcttcatcaacgaggcgcgcgccgccggg
cggctggtgcatccgaatatcgtcggcgtgttcgactacggcgaggccgacggcacggcc
tatatcgccttcgaatacgtgcgcggcgagaccctggccgcgcgactcgccgcgcacgcg
cgccagggcacgcgcatgccggcgcgcaacgtgctggtgtggttcgcgcaactgctggac
gcgctcgcctacgcgcacgagctcggcgtgatccatcgagacatcaagccggccaacctg
ctgatcgcaccgcgcggcgagtgcaagatcaccgacttcggcatcgcccagctcgatacc
gggcggctcacccaggtcggcatgctgatcggcacgcccagctacatgtcgccggagcag
gtctcgggcgcgccgatcgacgcgcgcagcgacctgttctcggccggcgtggtgctctac
gagatgctgaccggccgctgcccgttcgcaggctcgtcggcggcggtgatgcggcaggtg
ctcgacgagacgccctcgccgccctccagcctcgcgccggagctgccgcccgagctcgac
gcgatggtgctgcaggcgctggccaaggatccggggcagcgccacgcctcggcgcagcac
tggcgcggcgaagtgctggccctgctggagacgctcgcggccaggctcgacccggaccag
accatcgtgctcgcaccgctcgcgcaggcggcgctggccccgccgccggccgccgaggcg
cgcacgctgccggtcgactggtcgccggagttcctggcgcagttggagcagcggctggtc
acccatgtcgggccggtggcctcgcggctggtgcggcgcgcggcggcgcaggccaccgat
ccgcgcatgctggccgccgagctggcgcgccacctgcccgacgaggccgcgcgccaagac
ttcgatacgctgctgcagcgtcacgcggcttcgggcacggccgtcacgcgcgtgatgacg
atgccgggggcgacgcaggcgggcagcggggccggccaggcgccggccgtggatacagcg
ctggtcgagacggcggtgcagcggctcgccacccatatcgggccgatcgcgcggatcgtg
gcgcggcgcgcggcggtcgatgccgatctcgccaccttccaggcgcggctgctggaggcc
ctgccggattcggtggacaaggctgcgttcctgcgcgggctcgacgagggttcgtag

DBGET integrated database retrieval system