KEGG   Burkholderia glumae PG1: BGL_1c00910Help
Entry
BGL_1c00910       CDS       T03632                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase AcoD
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00010  Glycolysis / Gluconeogenesis
bgp00620  Pyruvate metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGL_1c00910 (acoD)
   00620 Pyruvate metabolism
    BGL_1c00910 (acoD)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BGL_1c00910 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJK44645
UniProt: A0A0B6RU80
LinkDB All DBs
Position
1:complement(106459..107979)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQHLNIEFPYRKQYGNFIGGEWIPPVGGDYFDNVSPVTGQPFTAIPRSQAADIEL
ALDAAHAARAAWGATPAAERAGILLKIADRMEANLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVWAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIAGYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAVQRVEKIRQGHPLDAQTMIGAQASEEQLEKILSYIDIGR
QEGAECLTGGARNTMTGELASGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEAEAL
EIANDTLYGLGAGVWTRDGNRAYHFGRDIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDKPAGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgccgagatgcaacacctgaacatcgaattcccgtaccgcaagcaatacggg
aacttcatcggtggcgaatggataccgcccgtcggcggcgactatttcgacaacgtctcg
cccgtcacgggccagccgttcaccgcgatcccgcgctcgcaggcggccgacatcgagctc
gcgctcgacgcggcgcacgcggcgcgcgccgcctggggcgcgaccccggcggccgagcgc
gcgggcatcctgctcaagatcgccgaccgcatggaagcgaacctcgcgcgcctcgcggtg
gccgagacgatcgacaacggcaagccgctgcgcgagaccaccgcggccgacatcccgctc
gcgatcgaccatttccgctatttcgcgggctgcgtgcgcgcgcaggaaggctcgatcgcc
gacatcggcggcgacctggtggcctaccacttccacgagccgctcggcgtggtcggccag
atcattccgtggaacttcccgatcctgatggccacctggaagctcgcgcccgcgctggcg
gccggcaactgcgtggtgctgaagccggccgagcagaccccggcctcgatcctggtgtgg
gccgagctgatccaggacctgctgccgcccggcgtgctcaacatcgtcaacggcttcggg
ctcgaggccggcaagccgctcgcctcgagcaagcggatcgccaagatcgcgttcacgggc
gagacctccacgggccgcctgatcgccggctacgcgagcgcgaacctgatcccggtcacg
ctcgaactcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctggtcgaggaaagcatctacgagcgcttcatcgagcgc
gccgtgcagcgcgtggaaaagatccgccagggccatccgctcgacgcgcagaccatgatc
ggcgcgcaggcctccgaggagcagctggagaagatcctgtcttacatcgacatcggccgc
caggaaggcgccgagtgcctgacgggcggcgcgcgcaacaccatgacgggcgaactggcg
agcggcttctacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggaaatcttcgggccggtgctgtcggtgacgaccttcaagaacgaggcggaagcgctc
gagatcgccaacgacacgctctatggcctcggcgccggcgtctggacccgcgacggcaac
cgcgcctatcacttcggccgcgacatccaggccgggcgcgtctggaccaactgctaccac
gcctatccggcgcacgcggcgttcggcggctacaagcagtccggcatcggccgcgagacg
cacaagatgatgctcgatcactaccagcagaccaagaacctgctggtcagctacagcgac
aagccggccggcctgttctga

DBGET integrated database retrieval system