KEGG   Burkholderia plantarii PG1: BGL_1c02970Help
Entry
BGL_1c02970       CDS       T03632                                 

Gene name
aroK1
Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01130  Biosynthesis of antibiotics
bgp01230  Biosynthesis of amino acids
Module
bgp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BGL_1c02970 (aroK1)
Enzymes [BR:bgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BGL_1c02970 (aroK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 FtsK_gamma AAA APS_kinase AAA_16 TsaE AAA_22 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AJK44840
UniProt: A0A0B6RUY2
LinkDB All DBs
Position
1:335316..335921
Genome map
AA seq 201 aa AA seqDB search
MPVSCATPPARLKQRKPLQPRDPYASVFFVGLMGAGKTTVGRAVARRLDRPFFDSDHEIE
ARTGTRIPVIFELEGEAGFRDREKKMIDELTQRGNVVLATGGGAVMRPENRDALRSRGIV
IYLRANPHDLWLRTRKDKNRPLLQTEDPKARLEALYEVRDPLYRECAHFVIETGRPSVNG
LVNMVLMQLELAGIVAKPLQA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgccagtaagctgcgccacaccaccagccagattgaagcagaggaagccgttgcaaccg
cgggatccatacgcaagcgtatttttcgtcggactcatgggggcgggtaaaaccaccgtg
ggtcgcgccgtcgcgcgccgtctcgaccggccgttcttcgattccgatcatgaaatcgaa
gcgcgcaccggtacgcggatcccggtcattttcgaactcgagggcgaggcgggtttccgc
gaccgcgagaaaaaaatgatcgacgagctcacccaacgcggcaacgtcgtgctcgcgacc
ggcggcggcgccgtgatgcgccccgaaaatcgcgacgcgctgcgttcgcgcggcatcgtc
atctatttgcgcgcgaatccgcacgatctctggctgagaacccgcaaggacaaaaatcgc
ccgctgctgcagacggaagatccgaaggcccggctcgaagcgttgtacgaggtgcgcgac
ccgctttaccgcgaatgcgcgcatttcgtgatcgagaccggccgtccgtcggtcaacggc
ctcgtcaacatggtgctgatgcagctcgagctggccggcatcgtcgccaagccgctacaa
gcatga

DBGET integrated database retrieval system