KEGG   Burkholderia plantarii PG1: BGL_1c05790Help
Entry
BGL_1c05790       CDS       T03632                                 

Gene name
rlmL
Definition
(GenBank) ribosomal RNA large subunit methyltransferase RlmL
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
bgp  Burkholderia plantarii PG1
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BGL_1c05790 (rlmL)
Enzymes [BR:bgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BGL_1c05790 (rlmL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP Methyltransf_25 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AJK45115
UniProt: A0A0B6RVL5
LinkDB All DBs
Position
1:complement(646514..647827)
Genome map
AA seq 437 aa AA seqDB search
MSSSLFDFFAPCPRGLEAALAAELAEIGARRTAGAPFEAGAQVPGGVHFRGGWMAGMATN
LHSRIASRVLLKIADRPYRSEQDVYALALEQQWERWFAATQTLRVDITAIKSPLKSLEFA
TLRVKDAICDRLREKTGARPSIDTALPDVRVFAFLTATHCTLYLDTSGEPLFKRGWRLDK
GAAPLRENLAAGILRVAGWTPAVPLYDPMCGSGTFLAEAAQIALDVAPGVERRFGFEKLK
QYDITAWQTLKVAAMDAKRAARGRRDALPVYGSDISGDMLDKARANLERAGVPGISLKQV
DARFMAPPADAPGLIVANPPYGERIEVRGRGPRGDARETGRNRGNDDAFRRTHVDAPDSE
FFIALGNALKQRFAGWQAFLLTSDRSLPGQLRLRESAKTPLFNGALECRLFRFDVVAGSV
RQRPADGDGGAAGTDDA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctccctattcgatttcttcgccccctgcccgcgtgggctcgaggccgcgctc
gcggccgaactggccgagatcggcgcgcggcgcaccgccggcgcgccgttcgaggccggc
gcccaggtgcccggcggcgtccatttccgcggcggctggatggccggcatggccaccaac
ctgcattcgcgcatcgcgagccgcgtgctgctgaagatcgccgatcgcccgtaccgcagc
gagcaggacgtctacgcgctcgcgctcgaacagcagtgggaacgctggttcgccgccacc
cagacgctgcgcgtcgacatcaccgcgatcaagtcgccgctcaagagcctcgagttcgcg
acgctgcgcgtgaaggacgcgatctgcgaccggctgcgcgagaagaccggcgcgcgcccg
agcatcgacaccgcgctgcccgacgtgcgcgtgttcgcgttcctgaccgcaacgcattgc
acgctctacctcgacacctccggcgagccgctgttcaagcgcggctggcggctcgacaag
ggcgcggcgccgctgcgcgagaacctcgcggccggcatcctgcgcgtggcgggctggacc
ccggccgtgccgctctacgatccgatgtgcggcagcggcacgttcctcgccgaggccgcg
cagatcgcgctcgacgtggcgccgggcgtggagcgccggttcggcttcgagaagctcaag
caatacgacatcaccgcgtggcagacgctgaaggtggccgcgatggacgccaagcgcgcc
gcgcgcggcaggcgcgacgcgctgccggtgtacggcagcgacatctccggcgacatgctc
gacaaggcgcgcgcgaacctcgaacgcgcgggcgtgccgggcatctcgctgaagcaggtc
gacgcgcgcttcatggcgccgcccgccgacgcgccggggctgatcgtggcgaacccgccg
tatggcgagcgcatcgaggtgcgcgggcgcggcccgcgcggcgacgcgcgcgagaccggc
cgcaatcgcggcaacgacgacgcgttccgccgcacccacgtcgacgcgcccgacagcgag
ttcttcatcgcgctcggcaacgcgctgaagcagcgcttcgcgggctggcaggcgttcctg
ctgacctcggaccgctcgctgcccggccagctgcgcctgcgcgaatcggccaagacgccg
ctcttcaacggcgcgctcgaatgccggctgttccgcttcgacgtggtggcgggcagcgtg
cgccagcgcccggcagacggcgacggcggcgcggcgggcaccgacgacgcgtag

DBGET integrated database retrieval system