KEGG   Burkholderia glumae PG1: BGL_1c11440Help
Entry
BGL_1c11440       CDS       T03632                                 

Definition
(GenBank) DNA primase, small subunit
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bgp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BGL_1c11440
Enzymes [BR:bgp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BGL_1c11440
DNA repair and recombination proteins [BR:bgp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BGL_1c11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M HC2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AJK45666
UniProt: A0A0B6S0A2
LinkDB All DBs
Position
1:1301574..1304489
Genome map
AA seq 971 aa AA seqDB search
MADPLSEYQRRRRFDATPEPAGAKRRRGAAGPLHFVVQEHHARRLHYDFRLELDGVLKSW
AVPKGPSLDPADKRLAVHVEDHPLDYAGFEGEIPPGHYGAGSVRIDDHGVWRPDGGVAGA
RRGYRDGKLTFELDGTKLRGRWSLICTAMPGAGGKSSWLLVKARDDAAGDVPADEPATRR
RIRHGKAAAKRAATKPAATKPAATKPAATKPAATKPAATKPAATKPAATKPAATKPAATK
PAATKPAATKPAATKPAATKPAATKPAATKPAATKSTATKSTATKSRTRSDLPGARRAAL
PDTLAPQLATLVAVPPEDEGWRYEMKFDGYRVLIRIAGRGRRRTVRMLTREGLDWSAKFG
AQCAAFAALPVDNAWLDAEAVVLDARGVPDFSALQQALSDGDDAAIVCFVFDLLHLDGRA
LQAVPLEARRERLAALLADSDSGCLRFSPTLDGPPAALLEAAAQAGLEGLIGKRADGAYR
AGRGSQWIKLKCRQRQEFVIGGYSAPRGSRSHFGALLLGVHAAPDGARRRGRHGAREPRA
LQYVGRVGTGFDARQLAALAKRLAALECERAPFAVPPPSRGDAVRWVEPTLVAECEFAGW
TADGLVRQAAFVALRDDKPAARIVRETAVPTAGQTTGTRMATTEPVTAGNARRGHRAGAN
EPTKATKATKATKAADSTVAGVRITHPERMVDPDGGFRKIDVVRYYASVARWLLPQLSGR
PVSLVRYMKGVGGESFFQKHAGERGMGFVTRHPGLDPGHDALMTLDDTAALVGAAQFDAL
EFHTWNATVDRIERPERLVFDLDPDPALPWERMIEAAGLVRALLDALGLPAFCKTSGGKG
LHLVVPITRHTEWDDAKAFSQAVARHLAGQLPDRFTAKMGPENRKGLIFVDYLRNGRGAS
TVAAYSARARPGMGVSVPLTWEEVAATTGGAQWTIANLPARLDTQRADPWEDYDAARTRI
TAAMRRRLGKL
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccccctttccgaataccagcgcaggcgccgcttcgacgcgacgcccgagccg
gcgggcgcgaagcggcggcgtggcgcggccgggccgctgcatttcgtggtgcaggagcat
cacgcgcggcgcctgcattacgacttccgtctcgaactggacggcgtgctgaaatcgtgg
gccgtgccgaaaggcccgagcctcgatccggccgacaagcggctcgccgtccacgtcgag
gaccatccgctcgactacgcgggtttcgagggcgagattccgcccggccactacggcgcg
ggtagcgtgcggatcgacgaccacggcgtctggcggcccgacggcggcgtggcgggcgca
cggcgcggctatcgcgacggcaagctcacgttcgaactcgacggcacgaagctgcggggg
cgctggtcgctgatctgcaccgcgatgccgggagccgggggcaagtcgtcgtggctgctc
gtgaaggcgcgcgacgacgcggccggcgacgtaccggcggacgaacccgccacgcgacga
cgcatccggcacggcaaggcggcggcgaagcgagccgccacgaaaccggccgccacgaaa
ccggccgccacgaaaccggccgccacgaaaccggccgccacgaaaccggccgccacgaaa
ccggccgccacgaaaccggccgccacgaaaccggccgccacgaaaccggccgccacgaaa
ccggccgccacgaaaccggccgccacgaaaccggccgccacgaaaccggccgccacgaaa
ccggccgccacgaaaccggccgccacgaaaccggccgccacgaaatcgacggcaacgaaa
tcgacggcaacgaaatcgcgcacccgaagcgatcttcccggcgcgcgccgcgccgcgttg
ccggacacgctcgcgccgcagctcgcgacgctcgtcgccgtgccgcccgaggacgagggc
tggcgctacgagatgaagttcgacggctaccgcgtgctgatccgcatcgccggtcgcggc
aggcgccgcacggtgcgcatgctgacgcgcgagggcctcgactggagcgcgaagtttggc
gcgcagtgcgcggcgttcgcggcgctgccggtcgacaacgcctggctcgacgccgaggcc
gtcgtgctcgacgcgcgcggcgtccccgatttttcggcgctgcagcaggcgctgtccgac
ggcgacgacgcggcgatcgtctgcttcgtgttcgacctgctgcatctggacggccgcgcg
ctgcaggccgtgccgctcgaggcgcgccgcgagcggctcgccgcgctgctggcggattcc
gattccggctgcctgcggttctcgccgacgctcgacggcccgccggcggcgctgctcgag
gccgccgcgcaagccggactcgaaggcctgatcggcaagcgcgccgacggcgcctaccgc
gccggacgcggcagccaatggatcaagctcaaatgccggcagcgccaggagttcgtgatc
ggcggctacagcgccccgcgcggcagccgcagccacttcggcgcgctgctgctcggcgtc
cacgcggcgccggacggcgcgcggcggcgtggccgccacggcgcgcgcgagccgcgcgcc
ctgcagtacgtcggccgcgtcggcaccggcttcgacgccaggcagctcgccgcgctggcg
aagcggctcgcggcgctcgaatgcgaacgcgcgccgttcgccgtgccgccgccttcacgc
ggcgacgcggtacgctgggtcgagccgacgctcgtcgccgaatgcgagttcgcgggctgg
accgccgacgggctggtgcggcaggcggcgttcgtcgcgctgcgcgacgacaagccggcc
gcgcgcatcgtcagggaaaccgccgtgccgacggcagggcaaaccacgggaaccaggatg
gccacgaccgaacccgtcacggccggcaacgccaggcgcggccatcgcgccggggcgaac
gagccgacgaaggcaacgaaggcaacgaaggcaacgaaagccgcggactcgaccgtggcg
ggcgtgcgcatcacgcatccggagcgcatggtcgatccggacggcggctttcgcaagatc
gacgtggtgcgctactacgcgtcggtcgcgcgctggctgctgccgcaactgagcgggcgg
cccgtgtcgctggtgcgctacatgaagggcgtcggcggcgaatcgttcttccagaagcac
gcgggcgagcgcggcatgggcttcgtcacgcgccacccggggctcgatcccggccacgac
gcgctgatgacgctcgacgacaccgccgcgctggtgggcgccgcgcagttcgacgcgctc
gaattccacacctggaacgcgacggtggaccggatcgagcggcccgagcgcctggtgttc
gacctcgatcccgatccggcgctgccgtgggagcggatgatcgaggcggccggcctggtg
cgcgcgctgctcgacgcactcgggctgcccgcgttctgcaagaccagcggcggcaagggg
ctgcacctggtggtgccgatcacgcggcatacggaatgggacgacgcgaaggcgttctcg
caggcggtggcgcggcatctggccgggcagctgccggaccgcttcaccgcgaagatgggg
ccggagaaccgcaagggcctgatcttcgtcgactacctgcgcaacgggcgcggcgcgagc
acggtagccgcctattcggcgcgcgcgcggcccgggatgggcgtatcggtgccgctcacc
tgggaggaggtggccgccaccacgggcggtgcgcagtggacgatcgccaacctgccggcg
cggctcgacacgcagcgggccgacccgtgggaggattacgatgccgcgcgcacgcgcatc
acggcggcgatgcgccggcgcctcggcaagctctga

DBGET integrated database retrieval system